Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4V669

Protein Details
Accession A0A2S4V669    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
144-170GDWAPEGKKRKNGKKLFHMHHSNKQLFHydrophilic
NLS Segment(s)
PositionSequence
150-158GKKRKNGKK
Subcellular Location(s) mito 10.5, cyto 10, cyto_nucl 8.833, mito_nucl 8.666, nucl 5.5
Family & Domain DBs
Amino Acid Sequences FYLACWMAHEGDLDTLVKVKGRRHLFWKVYVAKVCWIQHNIWKSYARVVEPSLGKKINIQLFPGNPTVLQQIRKLEHGKWILMQGYSAHSLLQEDGILKVKFPGKILSSFGVYKMDAFETSTHSQSTGYHLWNDPKKRFNLHVGDWAPEGKKRKNGKKLFHMHHSNKQLFSEVHS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.11
4 0.14
5 0.17
6 0.2
7 0.27
8 0.34
9 0.38
10 0.43
11 0.53
12 0.54
13 0.57
14 0.62
15 0.59
16 0.59
17 0.57
18 0.52
19 0.46
20 0.47
21 0.43
22 0.39
23 0.36
24 0.32
25 0.35
26 0.4
27 0.38
28 0.37
29 0.37
30 0.33
31 0.35
32 0.36
33 0.31
34 0.27
35 0.26
36 0.27
37 0.28
38 0.3
39 0.29
40 0.26
41 0.25
42 0.25
43 0.3
44 0.31
45 0.28
46 0.28
47 0.27
48 0.27
49 0.3
50 0.29
51 0.23
52 0.16
53 0.16
54 0.18
55 0.17
56 0.18
57 0.17
58 0.21
59 0.22
60 0.26
61 0.27
62 0.24
63 0.29
64 0.29
65 0.27
66 0.23
67 0.23
68 0.21
69 0.18
70 0.18
71 0.11
72 0.11
73 0.11
74 0.1
75 0.08
76 0.07
77 0.08
78 0.07
79 0.07
80 0.05
81 0.04
82 0.05
83 0.1
84 0.1
85 0.09
86 0.12
87 0.15
88 0.15
89 0.16
90 0.18
91 0.16
92 0.18
93 0.2
94 0.19
95 0.19
96 0.18
97 0.18
98 0.17
99 0.15
100 0.13
101 0.12
102 0.11
103 0.09
104 0.1
105 0.1
106 0.14
107 0.16
108 0.17
109 0.16
110 0.16
111 0.16
112 0.15
113 0.21
114 0.19
115 0.18
116 0.2
117 0.22
118 0.3
119 0.37
120 0.44
121 0.44
122 0.46
123 0.49
124 0.52
125 0.53
126 0.54
127 0.54
128 0.49
129 0.53
130 0.48
131 0.47
132 0.42
133 0.41
134 0.34
135 0.32
136 0.35
137 0.32
138 0.4
139 0.48
140 0.57
141 0.65
142 0.73
143 0.78
144 0.82
145 0.87
146 0.86
147 0.85
148 0.86
149 0.83
150 0.83
151 0.83
152 0.77
153 0.69
154 0.63
155 0.58