Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4V3Z7

Protein Details
Accession A0A2S4V3Z7    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-38MIKNRLIRLKMKGKRRRKKKTEEPPKKRVNPARSTKTTBasic
NLS Segment(s)
PositionSequence
6-57LIRLKMKGKRRRKKKTEEPPKKRVNPARSTKTTTQKEKPQDAQTPPKKKLRP
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 4
Family & Domain DBs
Amino Acid Sequences MIKNRLIRLKMKGKRRRKKKTEEPPKKRVNPARSTKTTTQKEKPQDAQTPPKKKLRPIKTAALIPPLTSTSESDHHKPEDAPQWKEDFSIYNLLNCCSGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.88
3 0.9
4 0.89
5 0.93
6 0.93
7 0.94
8 0.94
9 0.95
10 0.93
11 0.92
12 0.93
13 0.89
14 0.88
15 0.86
16 0.83
17 0.82
18 0.82
19 0.81
20 0.75
21 0.75
22 0.73
23 0.73
24 0.72
25 0.69
26 0.67
27 0.66
28 0.68
29 0.67
30 0.65
31 0.62
32 0.61
33 0.59
34 0.62
35 0.63
36 0.64
37 0.62
38 0.64
39 0.6
40 0.6
41 0.64
42 0.63
43 0.63
44 0.6
45 0.64
46 0.6
47 0.61
48 0.56
49 0.51
50 0.42
51 0.33
52 0.29
53 0.22
54 0.19
55 0.16
56 0.15
57 0.13
58 0.18
59 0.22
60 0.24
61 0.27
62 0.27
63 0.28
64 0.28
65 0.3
66 0.36
67 0.39
68 0.39
69 0.38
70 0.41
71 0.39
72 0.39
73 0.34
74 0.27
75 0.23
76 0.27
77 0.24
78 0.25
79 0.26
80 0.27