Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S4VFV4

Protein Details
Accession A0A2S4VFV4    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
87-111KRPILPYKTWRLQRMRRLKNHKGKIBasic
NLS Segment(s)
PositionSequence
99-111QRMRRLKNHKGKI
Subcellular Location(s) nucl 12, mito 11, cyto 1, plas 1, extr 1, golg 1
Family & Domain DBs
Amino Acid Sequences MASLISRSLLSGLIRPQNILGSSTITRRWASTSEIETETNEPSRQVYNPTPNPTYSCSRRLGPNGGILLSATAVQNLFNYPEFKHQKRPILPYKTWRLQRMRRLKNHKGKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.24
4 0.25
5 0.25
6 0.23
7 0.18
8 0.16
9 0.17
10 0.19
11 0.21
12 0.2
13 0.2
14 0.19
15 0.21
16 0.19
17 0.21
18 0.23
19 0.24
20 0.25
21 0.26
22 0.26
23 0.25
24 0.25
25 0.23
26 0.2
27 0.17
28 0.14
29 0.13
30 0.14
31 0.14
32 0.17
33 0.2
34 0.27
35 0.32
36 0.36
37 0.36
38 0.35
39 0.37
40 0.35
41 0.37
42 0.31
43 0.31
44 0.29
45 0.29
46 0.32
47 0.33
48 0.33
49 0.29
50 0.29
51 0.25
52 0.23
53 0.21
54 0.17
55 0.14
56 0.1
57 0.09
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.06
64 0.07
65 0.08
66 0.1
67 0.11
68 0.21
69 0.29
70 0.32
71 0.41
72 0.47
73 0.55
74 0.59
75 0.68
76 0.68
77 0.69
78 0.72
79 0.71
80 0.74
81 0.74
82 0.74
83 0.74
84 0.74
85 0.74
86 0.79
87 0.81
88 0.82
89 0.84
90 0.87
91 0.89