Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4VEP8

Protein Details
Accession A0A2S4VEP8    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
55-88KYHPEPPKYEKPKKEPKYKKPKEQPIYKKPKEDPBasic
NLS Segment(s)
PositionSequence
58-93PEPPKYEKPKKEPKYKKPKEQPIYKKPKEDPKYEKP
Subcellular Location(s) nucl 17.5, mito_nucl 13.666, cyto_nucl 10.333, mito 8.5
Family & Domain DBs
Amino Acid Sequences MSFLLPGYSSSSKNSKRGIYSPPNNYYGGHSLPHKPELLTKKPDLSYHPAPEHPKYHPEPPKYEKPKKEPKYKKPKEQPIYKKPKEDPKYEKPKEQPTYEKLNKDPKYSAPGYGYTPPKQGRYVH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.45
3 0.48
4 0.51
5 0.56
6 0.58
7 0.61
8 0.63
9 0.63
10 0.61
11 0.56
12 0.52
13 0.47
14 0.4
15 0.33
16 0.26
17 0.24
18 0.27
19 0.29
20 0.31
21 0.28
22 0.24
23 0.29
24 0.35
25 0.39
26 0.39
27 0.38
28 0.41
29 0.42
30 0.43
31 0.41
32 0.41
33 0.4
34 0.39
35 0.4
36 0.39
37 0.41
38 0.43
39 0.41
40 0.36
41 0.36
42 0.33
43 0.41
44 0.44
45 0.44
46 0.47
47 0.5
48 0.58
49 0.62
50 0.67
51 0.65
52 0.66
53 0.74
54 0.76
55 0.81
56 0.81
57 0.82
58 0.85
59 0.87
60 0.89
61 0.88
62 0.91
63 0.89
64 0.89
65 0.88
66 0.88
67 0.9
68 0.84
69 0.81
70 0.76
71 0.78
72 0.73
73 0.72
74 0.7
75 0.69
76 0.76
77 0.73
78 0.75
79 0.72
80 0.76
81 0.73
82 0.71
83 0.68
84 0.62
85 0.69
86 0.67
87 0.65
88 0.61
89 0.65
90 0.62
91 0.59
92 0.57
93 0.51
94 0.52
95 0.48
96 0.46
97 0.39
98 0.37
99 0.37
100 0.42
101 0.43
102 0.38
103 0.45
104 0.44
105 0.45