Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4UZQ6

Protein Details
Accession A0A2S4UZQ6   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
202-228VPRQPAQPTIPRKRRRSPSPTPRASTSHydrophilic
NLS Segment(s)
PositionSequence
213-218RKRRRS
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MVYSACDHCRRRGDDCFPSTAPRGISSKCEQCRLRKVACSNTRANPDPTSSTSVGTSVGASSAQPITLDSPPPPITIPSSPATNRRLASPSTSPVLRRVVGSPPLSPLSGSSSPVVASGRRRPRALQGHRLDSEPLNIARNRTRRNLPASHLTVDTRPDLLLLLRFTHRHRTTDLPLRPLNGPATESRPDGRRVQRVLGVFVPRQPAQPTIPRKRRRSPSPTPRASTSQSRDLGVGPSRRPDGADPLQQALEDFAGRMKELRDLQSELLSSLEQRLQQQLLAATPNVSTSTPTPEGTPPLM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.66
3 0.65
4 0.57
5 0.58
6 0.54
7 0.48
8 0.41
9 0.35
10 0.35
11 0.3
12 0.35
13 0.37
14 0.43
15 0.44
16 0.52
17 0.53
18 0.58
19 0.67
20 0.68
21 0.66
22 0.65
23 0.68
24 0.7
25 0.73
26 0.7
27 0.66
28 0.66
29 0.67
30 0.63
31 0.6
32 0.52
33 0.47
34 0.45
35 0.42
36 0.42
37 0.35
38 0.32
39 0.29
40 0.26
41 0.23
42 0.19
43 0.15
44 0.09
45 0.08
46 0.07
47 0.07
48 0.08
49 0.08
50 0.08
51 0.07
52 0.08
53 0.11
54 0.13
55 0.15
56 0.13
57 0.18
58 0.19
59 0.2
60 0.2
61 0.18
62 0.2
63 0.2
64 0.24
65 0.2
66 0.23
67 0.25
68 0.3
69 0.32
70 0.33
71 0.32
72 0.31
73 0.32
74 0.29
75 0.32
76 0.3
77 0.29
78 0.28
79 0.29
80 0.26
81 0.27
82 0.3
83 0.25
84 0.23
85 0.22
86 0.23
87 0.28
88 0.28
89 0.25
90 0.24
91 0.25
92 0.24
93 0.21
94 0.17
95 0.18
96 0.17
97 0.18
98 0.16
99 0.15
100 0.14
101 0.15
102 0.15
103 0.11
104 0.15
105 0.22
106 0.31
107 0.34
108 0.35
109 0.36
110 0.45
111 0.53
112 0.56
113 0.57
114 0.53
115 0.56
116 0.56
117 0.55
118 0.48
119 0.37
120 0.32
121 0.24
122 0.19
123 0.16
124 0.16
125 0.17
126 0.22
127 0.29
128 0.31
129 0.33
130 0.37
131 0.38
132 0.44
133 0.45
134 0.43
135 0.44
136 0.43
137 0.39
138 0.36
139 0.31
140 0.26
141 0.24
142 0.21
143 0.14
144 0.11
145 0.09
146 0.08
147 0.08
148 0.09
149 0.08
150 0.09
151 0.1
152 0.12
153 0.14
154 0.24
155 0.25
156 0.25
157 0.27
158 0.31
159 0.36
160 0.44
161 0.45
162 0.41
163 0.4
164 0.41
165 0.38
166 0.35
167 0.3
168 0.21
169 0.19
170 0.15
171 0.19
172 0.19
173 0.19
174 0.2
175 0.21
176 0.23
177 0.3
178 0.34
179 0.37
180 0.38
181 0.39
182 0.41
183 0.39
184 0.39
185 0.35
186 0.32
187 0.26
188 0.26
189 0.28
190 0.24
191 0.25
192 0.24
193 0.23
194 0.23
195 0.31
196 0.38
197 0.45
198 0.55
199 0.62
200 0.69
201 0.76
202 0.82
203 0.84
204 0.83
205 0.83
206 0.85
207 0.86
208 0.86
209 0.81
210 0.75
211 0.7
212 0.66
213 0.64
214 0.58
215 0.55
216 0.49
217 0.45
218 0.41
219 0.37
220 0.36
221 0.33
222 0.33
223 0.26
224 0.29
225 0.3
226 0.29
227 0.3
228 0.28
229 0.3
230 0.31
231 0.37
232 0.35
233 0.35
234 0.35
235 0.33
236 0.31
237 0.23
238 0.18
239 0.11
240 0.09
241 0.09
242 0.09
243 0.1
244 0.11
245 0.11
246 0.16
247 0.2
248 0.24
249 0.26
250 0.29
251 0.3
252 0.32
253 0.31
254 0.25
255 0.23
256 0.19
257 0.15
258 0.15
259 0.17
260 0.16
261 0.17
262 0.21
263 0.21
264 0.21
265 0.23
266 0.21
267 0.21
268 0.21
269 0.19
270 0.16
271 0.15
272 0.16
273 0.15
274 0.14
275 0.14
276 0.14
277 0.21
278 0.23
279 0.24
280 0.26
281 0.27