Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4UIL6

Protein Details
Accession A0A2S4UIL6    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
195-224DKTPHRILPPRWKAPPRKANQTTPAKPKQDHydrophilic
NLS Segment(s)
PositionSequence
134-148TRRGPRGILSRFRRR
202-235LPPRWKAPPRKANQTTPAKPKQDPAWWKVNRRRR
Subcellular Location(s) mito 19, nucl 5.5, cyto_nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000307  Ribosomal_S16  
IPR023803  Ribosomal_S16_dom_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00886  Ribosomal_S16  
Amino Acid Sequences MVIRIRLSRSGPRNHPLFNLVAIQSPKRRDAKPLEQLGIYSPQPILRVKQPSLIELVHNIHLAKHFKDPKALDRINHGIANGGKSFSGRKSDGMSIAFGIGSANQLRDLKLLRSKTSKVGTKPRIPLRVAIATTRRGPRGILSRFRRRGLLPLGTRVLPNGKLRIPPSVTKTGKALMLDTSNWTERLEKGASIVDKTPHRILPPRWKAPPRKANQTTPAKPKQDPAWWKVNRRRRAAALALTDQLPKPRYSSKNVSKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.58
3 0.52
4 0.45
5 0.38
6 0.35
7 0.28
8 0.28
9 0.29
10 0.31
11 0.34
12 0.36
13 0.42
14 0.43
15 0.44
16 0.47
17 0.54
18 0.59
19 0.63
20 0.67
21 0.62
22 0.55
23 0.54
24 0.49
25 0.44
26 0.33
27 0.25
28 0.18
29 0.17
30 0.19
31 0.2
32 0.21
33 0.23
34 0.3
35 0.3
36 0.36
37 0.36
38 0.35
39 0.36
40 0.34
41 0.27
42 0.24
43 0.25
44 0.2
45 0.2
46 0.19
47 0.17
48 0.21
49 0.23
50 0.21
51 0.27
52 0.33
53 0.33
54 0.4
55 0.42
56 0.44
57 0.51
58 0.51
59 0.43
60 0.43
61 0.46
62 0.42
63 0.4
64 0.33
65 0.26
66 0.25
67 0.26
68 0.2
69 0.16
70 0.13
71 0.13
72 0.15
73 0.13
74 0.18
75 0.16
76 0.17
77 0.2
78 0.22
79 0.24
80 0.23
81 0.21
82 0.16
83 0.15
84 0.13
85 0.1
86 0.08
87 0.05
88 0.06
89 0.06
90 0.06
91 0.07
92 0.08
93 0.08
94 0.1
95 0.11
96 0.13
97 0.18
98 0.2
99 0.22
100 0.26
101 0.27
102 0.32
103 0.37
104 0.39
105 0.39
106 0.47
107 0.51
108 0.53
109 0.59
110 0.6
111 0.59
112 0.55
113 0.51
114 0.45
115 0.42
116 0.36
117 0.31
118 0.27
119 0.24
120 0.28
121 0.28
122 0.24
123 0.2
124 0.2
125 0.21
126 0.27
127 0.31
128 0.36
129 0.41
130 0.51
131 0.55
132 0.56
133 0.55
134 0.46
135 0.47
136 0.43
137 0.43
138 0.35
139 0.34
140 0.35
141 0.33
142 0.32
143 0.27
144 0.24
145 0.19
146 0.2
147 0.19
148 0.19
149 0.23
150 0.24
151 0.29
152 0.29
153 0.29
154 0.33
155 0.4
156 0.39
157 0.36
158 0.37
159 0.33
160 0.32
161 0.28
162 0.23
163 0.15
164 0.16
165 0.15
166 0.16
167 0.17
168 0.17
169 0.17
170 0.17
171 0.16
172 0.15
173 0.19
174 0.17
175 0.14
176 0.15
177 0.18
178 0.19
179 0.19
180 0.21
181 0.21
182 0.22
183 0.27
184 0.29
185 0.27
186 0.3
187 0.35
188 0.41
189 0.48
190 0.55
191 0.59
192 0.64
193 0.72
194 0.78
195 0.81
196 0.83
197 0.8
198 0.81
199 0.8
200 0.8
201 0.81
202 0.82
203 0.79
204 0.79
205 0.8
206 0.75
207 0.69
208 0.67
209 0.64
210 0.64
211 0.63
212 0.59
213 0.6
214 0.61
215 0.7
216 0.74
217 0.77
218 0.76
219 0.76
220 0.77
221 0.72
222 0.73
223 0.7
224 0.67
225 0.63
226 0.58
227 0.52
228 0.46
229 0.43
230 0.36
231 0.35
232 0.31
233 0.25
234 0.27
235 0.34
236 0.38
237 0.44
238 0.54