Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4V900

Protein Details
Accession A0A2S4V900    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
5-32VKAALAKEQKKRSIKPKPTQARNESRNLHydrophilic
NLS Segment(s)
PositionSequence
13-21QKKRSIKPK
110-114KKKAK
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
Amino Acid Sequences EQKMVKAALAKEQKKRSIKPKPTQARNESRNLALEDIDWDQKDVKDRAGDNILENKPWLNKLDHGQVIANTYQRPIVFISMESSATFIPSVWKTNLKKQLNIYNQELKNKKKAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.74
3 0.75
4 0.76
5 0.81
6 0.82
7 0.85
8 0.86
9 0.88
10 0.9
11 0.89
12 0.88
13 0.83
14 0.79
15 0.72
16 0.62
17 0.56
18 0.47
19 0.38
20 0.28
21 0.22
22 0.18
23 0.16
24 0.17
25 0.13
26 0.12
27 0.13
28 0.13
29 0.19
30 0.17
31 0.17
32 0.19
33 0.19
34 0.22
35 0.24
36 0.23
37 0.19
38 0.27
39 0.25
40 0.21
41 0.21
42 0.19
43 0.16
44 0.17
45 0.17
46 0.11
47 0.13
48 0.16
49 0.21
50 0.21
51 0.21
52 0.21
53 0.19
54 0.2
55 0.18
56 0.17
57 0.11
58 0.11
59 0.12
60 0.12
61 0.12
62 0.11
63 0.12
64 0.11
65 0.11
66 0.13
67 0.12
68 0.13
69 0.11
70 0.11
71 0.09
72 0.1
73 0.09
74 0.07
75 0.11
76 0.12
77 0.16
78 0.17
79 0.26
80 0.29
81 0.39
82 0.49
83 0.49
84 0.53
85 0.56
86 0.64
87 0.64
88 0.66
89 0.64
90 0.63
91 0.63
92 0.68
93 0.68
94 0.64