Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4UC33

Protein Details
Accession A0A2S4UC33    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
4-24VRIVSTSKGKKRKQAEADNSVHydrophilic
156-178ATKNVGIKPKKLSKPKPVRVGGLHydrophilic
NLS Segment(s)
PositionSequence
163-172KPKKLSKPKP
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Amino Acid Sequences MVRVRIVSTSKGKKRKQAEADNSVDEDMGEIERAKDDGDKQALTTGINEKQLFGTCPHPSPRDGSRGIRSNLELIDTTSSNIPFYLDPMGCARRYMVAQIAQEEEIELEHLALELKAFAAHAGRCTIREEDVKLQELLEEESQHCNTTSSTLTAAATKNVGIKPKKLSKPKPVRVGGLAGTSTSRNPIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.79
3 0.8
4 0.8
5 0.8
6 0.79
7 0.78
8 0.72
9 0.65
10 0.55
11 0.44
12 0.33
13 0.23
14 0.15
15 0.1
16 0.08
17 0.07
18 0.07
19 0.08
20 0.08
21 0.08
22 0.1
23 0.12
24 0.17
25 0.2
26 0.2
27 0.2
28 0.22
29 0.22
30 0.2
31 0.2
32 0.18
33 0.18
34 0.23
35 0.23
36 0.21
37 0.22
38 0.23
39 0.22
40 0.19
41 0.22
42 0.19
43 0.23
44 0.26
45 0.27
46 0.27
47 0.3
48 0.31
49 0.32
50 0.34
51 0.35
52 0.37
53 0.42
54 0.43
55 0.4
56 0.37
57 0.33
58 0.29
59 0.25
60 0.18
61 0.12
62 0.13
63 0.11
64 0.11
65 0.1
66 0.1
67 0.09
68 0.09
69 0.09
70 0.07
71 0.08
72 0.11
73 0.09
74 0.1
75 0.12
76 0.15
77 0.14
78 0.14
79 0.13
80 0.11
81 0.11
82 0.11
83 0.11
84 0.12
85 0.13
86 0.14
87 0.14
88 0.13
89 0.13
90 0.12
91 0.09
92 0.05
93 0.06
94 0.05
95 0.03
96 0.03
97 0.03
98 0.04
99 0.04
100 0.04
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.05
107 0.06
108 0.07
109 0.09
110 0.1
111 0.11
112 0.14
113 0.15
114 0.16
115 0.18
116 0.2
117 0.25
118 0.27
119 0.29
120 0.26
121 0.25
122 0.23
123 0.21
124 0.2
125 0.15
126 0.13
127 0.12
128 0.17
129 0.17
130 0.17
131 0.17
132 0.15
133 0.14
134 0.15
135 0.15
136 0.12
137 0.13
138 0.13
139 0.13
140 0.15
141 0.16
142 0.14
143 0.14
144 0.13
145 0.17
146 0.18
147 0.26
148 0.26
149 0.3
150 0.38
151 0.48
152 0.56
153 0.63
154 0.7
155 0.73
156 0.82
157 0.86
158 0.87
159 0.82
160 0.78
161 0.71
162 0.66
163 0.57
164 0.49
165 0.4
166 0.3
167 0.27
168 0.23
169 0.2