Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4VKJ5

Protein Details
Accession A0A2S4VKJ5   
Localization Confidence Low
Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
4-29PHLYPVYRSKKKFEHRQFPIAKKPRHBasic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito_nucl 10.666, cyto_nucl 10.333, mito 7.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000089  Biotin_lipoyl  
IPR002930  GCV_H  
IPR033753  GCV_H/Fam206  
IPR017453  GCV_H_sub  
IPR011053  Single_hybrid_motif  
Gene Ontology GO:0005960  C:glycine cleavage complex  
GO:0005739  C:mitochondrion  
GO:0019464  P:glycine decarboxylation via glycine cleavage system  
Pfam View protein in Pfam  
PF01597  GCV_H  
PROSITE View protein in PROSITE  
PS50968  BIOTINYL_LIPOYL  
CDD cd06848  GCS_H  
Amino Acid Sequences SVEPHLYPVYRSKKKFEHRQFPIAKKPRHLSMSASLLLRPVFRSCRLTAPTCSINRLSGVSSIGFTRFVSTKRYTKEHEWVTLDTETNIGTIGITDYAQNSLGDVVFVELPEVSATVATGELIGAVESVKAASDIFAPVSGTVTEVNTKLTDQAGLLNTSPEDEGWLAKIKLSSPEELEKLLSEESYKAHIEGEH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.78
3 0.8
4 0.8
5 0.79
6 0.86
7 0.87
8 0.85
9 0.86
10 0.84
11 0.79
12 0.76
13 0.74
14 0.71
15 0.66
16 0.6
17 0.54
18 0.51
19 0.51
20 0.45
21 0.4
22 0.33
23 0.3
24 0.29
25 0.24
26 0.19
27 0.18
28 0.18
29 0.21
30 0.26
31 0.26
32 0.33
33 0.37
34 0.39
35 0.38
36 0.39
37 0.43
38 0.39
39 0.41
40 0.34
41 0.31
42 0.28
43 0.26
44 0.21
45 0.15
46 0.15
47 0.12
48 0.12
49 0.11
50 0.11
51 0.1
52 0.09
53 0.1
54 0.11
55 0.12
56 0.17
57 0.21
58 0.26
59 0.3
60 0.34
61 0.37
62 0.4
63 0.47
64 0.45
65 0.45
66 0.42
67 0.39
68 0.38
69 0.34
70 0.29
71 0.2
72 0.17
73 0.12
74 0.09
75 0.09
76 0.05
77 0.04
78 0.03
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.05
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.03
97 0.04
98 0.04
99 0.04
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.04
121 0.05
122 0.05
123 0.06
124 0.06
125 0.06
126 0.07
127 0.07
128 0.07
129 0.07
130 0.08
131 0.09
132 0.09
133 0.11
134 0.1
135 0.1
136 0.11
137 0.11
138 0.1
139 0.09
140 0.12
141 0.13
142 0.14
143 0.14
144 0.14
145 0.13
146 0.14
147 0.14
148 0.09
149 0.1
150 0.09
151 0.09
152 0.1
153 0.15
154 0.14
155 0.16
156 0.17
157 0.16
158 0.24
159 0.26
160 0.27
161 0.26
162 0.32
163 0.32
164 0.32
165 0.31
166 0.24
167 0.24
168 0.22
169 0.18
170 0.13
171 0.13
172 0.14
173 0.17
174 0.17
175 0.15