Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4UK60

Protein Details
Accession A0A2S4UK60   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
110-138MTMPQTKKKFLKLRQSKVTSRRAKKLQKIHydrophilic
NLS Segment(s)
PositionSequence
107-138KRRMTMPQTKKKFLKLRQSKVTSRRAKKLQKI
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences NKQSLLGESSPTVKEATTLKDPCDHHPPFVYSSSTDSQVSVLEVMSSKGKHNSTASTYSSNKKRREHGLSPSSNGQPESVAQASPGEKSKNPQRAPNHLKRQTLMTKRRMTMPQTKKKFLKLRQSKVTSRRAKKLQKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.21
4 0.27
5 0.28
6 0.29
7 0.35
8 0.37
9 0.4
10 0.47
11 0.43
12 0.37
13 0.39
14 0.4
15 0.36
16 0.37
17 0.34
18 0.25
19 0.28
20 0.27
21 0.25
22 0.23
23 0.2
24 0.17
25 0.16
26 0.15
27 0.1
28 0.08
29 0.06
30 0.06
31 0.07
32 0.09
33 0.09
34 0.1
35 0.15
36 0.16
37 0.18
38 0.19
39 0.21
40 0.23
41 0.27
42 0.27
43 0.28
44 0.3
45 0.34
46 0.41
47 0.47
48 0.49
49 0.49
50 0.52
51 0.55
52 0.61
53 0.59
54 0.59
55 0.61
56 0.56
57 0.54
58 0.52
59 0.45
60 0.37
61 0.32
62 0.23
63 0.14
64 0.13
65 0.14
66 0.11
67 0.1
68 0.09
69 0.1
70 0.11
71 0.12
72 0.14
73 0.13
74 0.13
75 0.19
76 0.27
77 0.35
78 0.37
79 0.44
80 0.48
81 0.56
82 0.66
83 0.71
84 0.73
85 0.71
86 0.71
87 0.64
88 0.65
89 0.64
90 0.64
91 0.63
92 0.61
93 0.62
94 0.61
95 0.66
96 0.64
97 0.61
98 0.62
99 0.64
100 0.65
101 0.66
102 0.74
103 0.71
104 0.76
105 0.79
106 0.77
107 0.78
108 0.78
109 0.8
110 0.82
111 0.85
112 0.84
113 0.84
114 0.85
115 0.85
116 0.82
117 0.82
118 0.82