Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S4VZK8

Protein Details
Accession A0A2S4VZK8    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MNDRDRTYRRDRRIDGRRSSRVBasic
NLS Segment(s)
Subcellular Location(s) cyto 13, nucl 9, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR017440  Cit_synth/succinyl-CoA_lig_AS  
IPR005811  CoA_ligase  
IPR016102  Succinyl-CoA_synth-like  
Gene Ontology GO:0003824  F:catalytic activity  
Pfam View protein in Pfam  
PF00549  Ligase_CoA  
PROSITE View protein in PROSITE  
PS00399  SUCCINYL_COA_LIG_2  
Amino Acid Sequences MNDRDRTYRRDRRIDGRRSSRVLKQFNKTRAVPKPVVSFIAGRTAPPGRRMGHAGAIISGGKGKAEDKVKALEEAGAVVSDSPAKLAILC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.82
4 0.8
5 0.75
6 0.74
7 0.71
8 0.69
9 0.69
10 0.65
11 0.65
12 0.67
13 0.68
14 0.69
15 0.64
16 0.63
17 0.62
18 0.62
19 0.55
20 0.5
21 0.48
22 0.43
23 0.41
24 0.34
25 0.27
26 0.2
27 0.24
28 0.2
29 0.15
30 0.16
31 0.18
32 0.18
33 0.19
34 0.22
35 0.18
36 0.19
37 0.22
38 0.21
39 0.22
40 0.22
41 0.2
42 0.16
43 0.15
44 0.14
45 0.11
46 0.1
47 0.06
48 0.05
49 0.06
50 0.06
51 0.11
52 0.15
53 0.17
54 0.19
55 0.23
56 0.25
57 0.25
58 0.25
59 0.2
60 0.17
61 0.15
62 0.13
63 0.09
64 0.08
65 0.07
66 0.07
67 0.07
68 0.07
69 0.06
70 0.07