Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S4VE73

Protein Details
Accession A0A2S4VE73    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
12-42GKVRSQCPKVAKQERTKKKLQGRAKKRCLYNHydrophilic
NLS Segment(s)
PositionSequence
22-38AKQERTKKKLQGRAKKR
Subcellular Location(s) nucl 13, mito 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVRSQCPKVAKQERTKKKLQGRAKKRCLYNNRFAITTPHGGRRKMNPAPAGKMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.44
3 0.45
4 0.46
5 0.5
6 0.58
7 0.62
8 0.66
9 0.68
10 0.69
11 0.76
12 0.8
13 0.8
14 0.78
15 0.76
16 0.75
17 0.76
18 0.75
19 0.75
20 0.76
21 0.81
22 0.84
23 0.82
24 0.79
25 0.78
26 0.79
27 0.76
28 0.75
29 0.72
30 0.65
31 0.59
32 0.54
33 0.5
34 0.44
35 0.43
36 0.36
37 0.37
38 0.4
39 0.41
40 0.45
41 0.48
42 0.53
43 0.52
44 0.57
45 0.55
46 0.56