Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S4V761

Protein Details
Accession A0A2S4V761    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
55-74VDILKDRKKKHEAKKILAIAHydrophilic
NLS Segment(s)
PositionSequence
61-69RKKKHEAKK
Subcellular Location(s) nucl 16, cyto_nucl 13, cyto 8
Family & Domain DBs
Amino Acid Sequences MDSWGNRKVVDYRDWNETIDRSHELWDKTVKGVKDDYKKYSKAFGVQDVITKGFVDILKDRKKKHEAKKILAIAEHKYYKLFNPFLRLLGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.43
3 0.4
4 0.36
5 0.31
6 0.27
7 0.27
8 0.21
9 0.24
10 0.27
11 0.26
12 0.27
13 0.29
14 0.27
15 0.26
16 0.29
17 0.26
18 0.23
19 0.27
20 0.31
21 0.36
22 0.39
23 0.42
24 0.44
25 0.46
26 0.45
27 0.45
28 0.39
29 0.36
30 0.33
31 0.3
32 0.27
33 0.24
34 0.25
35 0.21
36 0.21
37 0.15
38 0.13
39 0.1
40 0.1
41 0.1
42 0.1
43 0.13
44 0.21
45 0.3
46 0.35
47 0.38
48 0.44
49 0.53
50 0.61
51 0.68
52 0.7
53 0.7
54 0.73
55 0.8
56 0.77
57 0.7
58 0.63
59 0.56
60 0.49
61 0.47
62 0.42
63 0.32
64 0.28
65 0.28
66 0.29
67 0.34
68 0.36
69 0.31
70 0.37
71 0.38