Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4VPK3

Protein Details
Accession A0A2S4VPK3    Localization Confidence High Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
20-46MCGPSTMETKPKRRPRPKKLDLIEPVTHydrophilic
107-132IPDNPTLKTQRKKRHRSHKVGPLEPLHydrophilic
NLS Segment(s)
PositionSequence
29-38KPKRRPRPKK
87-89RPK
117-123RKKRHRS
Subcellular Location(s) cyto_nucl 12.5, nucl 12, cyto 9, mito 6
Family & Domain DBs
Amino Acid Sequences MVVFAAPLAAAELPISDAPMCGPSTMETKPKRRPRPKKLDLIEPVTKASIATPLVNSPIAHPPISDNPTTVPPTIVTQPTKPKIPIRPKKVGKILPPAEVMFPDTLIPDNPTLKTQRKKRHRSHKVGPLEPLTTVVPAIQTLLLPNVGLPEKPRKTSSQNLLPPLLPSSPSSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.07
4 0.07
5 0.08
6 0.1
7 0.1
8 0.09
9 0.1
10 0.1
11 0.14
12 0.17
13 0.26
14 0.31
15 0.39
16 0.5
17 0.6
18 0.69
19 0.77
20 0.85
21 0.88
22 0.91
23 0.92
24 0.92
25 0.87
26 0.86
27 0.81
28 0.77
29 0.71
30 0.61
31 0.52
32 0.42
33 0.37
34 0.26
35 0.2
36 0.15
37 0.12
38 0.11
39 0.11
40 0.11
41 0.13
42 0.14
43 0.14
44 0.13
45 0.18
46 0.18
47 0.18
48 0.17
49 0.18
50 0.23
51 0.26
52 0.24
53 0.18
54 0.18
55 0.22
56 0.23
57 0.21
58 0.15
59 0.13
60 0.15
61 0.17
62 0.19
63 0.17
64 0.19
65 0.26
66 0.28
67 0.3
68 0.31
69 0.34
70 0.39
71 0.49
72 0.54
73 0.55
74 0.62
75 0.64
76 0.68
77 0.71
78 0.67
79 0.61
80 0.62
81 0.56
82 0.49
83 0.46
84 0.39
85 0.32
86 0.27
87 0.23
88 0.13
89 0.11
90 0.08
91 0.07
92 0.07
93 0.07
94 0.08
95 0.09
96 0.1
97 0.11
98 0.13
99 0.18
100 0.26
101 0.34
102 0.42
103 0.51
104 0.6
105 0.7
106 0.79
107 0.85
108 0.88
109 0.89
110 0.9
111 0.89
112 0.88
113 0.81
114 0.75
115 0.67
116 0.57
117 0.47
118 0.39
119 0.3
120 0.2
121 0.16
122 0.12
123 0.09
124 0.08
125 0.08
126 0.06
127 0.06
128 0.06
129 0.08
130 0.07
131 0.07
132 0.07
133 0.09
134 0.1
135 0.11
136 0.14
137 0.23
138 0.28
139 0.32
140 0.36
141 0.39
142 0.45
143 0.55
144 0.6
145 0.6
146 0.63
147 0.64
148 0.64
149 0.58
150 0.52
151 0.46
152 0.38
153 0.29