Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4VDC9

Protein Details
Accession A0A2S4VDC9    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
26-54TTVSRHSTRQKSDRRTRPRWAQLNRVHPIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
Amino Acid Sequences MSLDARPGENGPHIDSPHLHQSQQVTTVSRHSTRQKSDRRTRPRWAQLNRVHPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.25
4 0.3
5 0.29
6 0.25
7 0.24
8 0.26
9 0.25
10 0.27
11 0.25
12 0.17
13 0.17
14 0.2
15 0.21
16 0.2
17 0.24
18 0.28
19 0.34
20 0.4
21 0.49
22 0.55
23 0.63
24 0.72
25 0.78
26 0.8
27 0.82
28 0.84
29 0.85
30 0.86
31 0.86
32 0.83
33 0.83
34 0.82