Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S4W388

Protein Details
Accession A0A2S4W388    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
87-109APSGGTKRKAPPRSKPPLLNFNLHydrophilic
NLS Segment(s)
PositionSequence
93-99KRKAPPR
Subcellular Location(s) extr 16, mito 6, nucl 3
Family & Domain DBs
Amino Acid Sequences MATRTAPTPLHTNESTNLSAPNLLNSCLLALLVPALNGKDKELDIPVPACGSEHPPQTPERNKSQPDKVDEEAAAVRGCTGSPAPQAPSGGTKRKAPPRSKPPLLNFNLIICSMGPSGDGLPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.34
3 0.28
4 0.26
5 0.2
6 0.22
7 0.19
8 0.22
9 0.18
10 0.17
11 0.17
12 0.16
13 0.15
14 0.12
15 0.11
16 0.06
17 0.05
18 0.05
19 0.05
20 0.05
21 0.05
22 0.06
23 0.08
24 0.08
25 0.09
26 0.1
27 0.1
28 0.11
29 0.13
30 0.13
31 0.12
32 0.12
33 0.12
34 0.1
35 0.1
36 0.09
37 0.08
38 0.12
39 0.14
40 0.16
41 0.16
42 0.17
43 0.2
44 0.27
45 0.33
46 0.32
47 0.36
48 0.4
49 0.44
50 0.48
51 0.52
52 0.5
53 0.48
54 0.49
55 0.43
56 0.38
57 0.34
58 0.31
59 0.24
60 0.2
61 0.15
62 0.1
63 0.09
64 0.06
65 0.06
66 0.06
67 0.06
68 0.07
69 0.09
70 0.11
71 0.13
72 0.14
73 0.15
74 0.15
75 0.21
76 0.25
77 0.3
78 0.31
79 0.36
80 0.43
81 0.52
82 0.61
83 0.62
84 0.68
85 0.71
86 0.79
87 0.81
88 0.81
89 0.79
90 0.8
91 0.76
92 0.71
93 0.62
94 0.53
95 0.47
96 0.38
97 0.31
98 0.21
99 0.19
100 0.14
101 0.12
102 0.1
103 0.1