Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S4UNI2

Protein Details
Accession A0A2S4UNI2    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-37LSNPKLSVRPLKPPRRSRRTCSAQCDHydrophilic
NLS Segment(s)
PositionSequence
21-28PLKPPRRS
Subcellular Location(s) mito_nucl 14.333, mito 14, nucl 12.5, cyto_nucl 7.166
Family & Domain DBs
Amino Acid Sequences MTYPLKLKLSKLSNPKLSVRPLKPPRRSRRTCSAQCDASNIEGARPFDQLTLSDIDKAEPRIAKTVETMVKKGKWTVEGYSEKFGNLSVM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.65
3 0.62
4 0.63
5 0.65
6 0.59
7 0.61
8 0.64
9 0.7
10 0.74
11 0.8
12 0.82
13 0.83
14 0.87
15 0.83
16 0.83
17 0.83
18 0.81
19 0.78
20 0.73
21 0.67
22 0.61
23 0.57
24 0.47
25 0.37
26 0.31
27 0.24
28 0.18
29 0.15
30 0.15
31 0.13
32 0.12
33 0.12
34 0.1
35 0.1
36 0.1
37 0.09
38 0.11
39 0.1
40 0.11
41 0.11
42 0.11
43 0.13
44 0.14
45 0.15
46 0.15
47 0.16
48 0.19
49 0.2
50 0.2
51 0.2
52 0.25
53 0.28
54 0.29
55 0.3
56 0.31
57 0.33
58 0.34
59 0.36
60 0.33
61 0.31
62 0.32
63 0.32
64 0.36
65 0.4
66 0.42
67 0.44
68 0.42
69 0.37
70 0.34