Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4V418

Protein Details
Accession A0A2S4V418    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
78-104FGPFIGRSKPCKRKIRQRNREDKVVKFHydrophilic
NLS Segment(s)
PositionSequence
89-97KRKIRQRNR
Subcellular Location(s) mito 13, cyto_nucl 9.5, nucl 8, cyto 5
Family & Domain DBs
Amino Acid Sequences MRRRGGGRGVGRRKSNSFLDGILTIPGFKQIKKDPDYVYRLPENITRPIVRQLDKEDHEETIEKQPRHSKASIILNSFGPFIGRSKPCKRKIRQRNREDKVVKFLQKSARPKIVFTLMQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.58
3 0.5
4 0.42
5 0.35
6 0.32
7 0.27
8 0.23
9 0.19
10 0.14
11 0.12
12 0.1
13 0.16
14 0.14
15 0.14
16 0.2
17 0.25
18 0.34
19 0.38
20 0.43
21 0.4
22 0.47
23 0.54
24 0.5
25 0.48
26 0.42
27 0.38
28 0.35
29 0.35
30 0.3
31 0.27
32 0.28
33 0.24
34 0.23
35 0.29
36 0.32
37 0.29
38 0.28
39 0.29
40 0.32
41 0.33
42 0.36
43 0.3
44 0.26
45 0.25
46 0.24
47 0.21
48 0.24
49 0.28
50 0.24
51 0.26
52 0.32
53 0.35
54 0.39
55 0.38
56 0.3
57 0.3
58 0.4
59 0.41
60 0.36
61 0.34
62 0.31
63 0.3
64 0.29
65 0.22
66 0.13
67 0.1
68 0.1
69 0.15
70 0.18
71 0.26
72 0.36
73 0.46
74 0.55
75 0.65
76 0.73
77 0.77
78 0.85
79 0.89
80 0.9
81 0.91
82 0.92
83 0.89
84 0.9
85 0.84
86 0.78
87 0.75
88 0.73
89 0.68
90 0.59
91 0.58
92 0.57
93 0.6
94 0.64
95 0.64
96 0.65
97 0.6
98 0.59
99 0.59