Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4VT44

Protein Details
Accession A0A2S4VT44   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
146-168VTKYDEKGKLREPNKKKKQPKPKBasic
NLS Segment(s)
PositionSequence
152-168KGKLREPNKKKKQPKPK
Subcellular Location(s) cyto 14, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR046798  2OG-FeII_Oxy_6  
Pfam View protein in Pfam  
PF20515  2OG-FeII_Oxy_6  
Amino Acid Sequences YLISNSNAFTCHLSFTLDNFYNEAHTNKDLSPCTFVTWIPINQQAGELAEDHFEVEGGEFVFPKDGCAVDFMRFNSIVECAWKASDHFHHTLPSPAPMGSPHTQLGISSQLPESAERALQTHQDEIPDYKKLWTIRDLEKVVKDAVTKYDEKGKLREPNKKKKQPKPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.26
4 0.26
5 0.25
6 0.24
7 0.24
8 0.23
9 0.24
10 0.23
11 0.19
12 0.17
13 0.19
14 0.2
15 0.25
16 0.25
17 0.25
18 0.28
19 0.25
20 0.26
21 0.25
22 0.23
23 0.22
24 0.24
25 0.24
26 0.22
27 0.26
28 0.24
29 0.23
30 0.23
31 0.19
32 0.16
33 0.15
34 0.12
35 0.08
36 0.08
37 0.08
38 0.08
39 0.07
40 0.06
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.07
49 0.07
50 0.07
51 0.07
52 0.07
53 0.07
54 0.1
55 0.11
56 0.1
57 0.13
58 0.13
59 0.14
60 0.14
61 0.14
62 0.12
63 0.11
64 0.1
65 0.09
66 0.09
67 0.07
68 0.07
69 0.07
70 0.07
71 0.09
72 0.13
73 0.16
74 0.17
75 0.18
76 0.19
77 0.19
78 0.22
79 0.2
80 0.18
81 0.14
82 0.12
83 0.12
84 0.12
85 0.17
86 0.15
87 0.16
88 0.15
89 0.15
90 0.15
91 0.15
92 0.16
93 0.14
94 0.12
95 0.11
96 0.11
97 0.11
98 0.12
99 0.13
100 0.12
101 0.09
102 0.1
103 0.09
104 0.1
105 0.11
106 0.14
107 0.15
108 0.17
109 0.16
110 0.17
111 0.18
112 0.2
113 0.21
114 0.2
115 0.19
116 0.18
117 0.22
118 0.23
119 0.25
120 0.28
121 0.31
122 0.34
123 0.42
124 0.44
125 0.43
126 0.44
127 0.43
128 0.38
129 0.34
130 0.3
131 0.23
132 0.24
133 0.25
134 0.24
135 0.24
136 0.33
137 0.36
138 0.38
139 0.42
140 0.46
141 0.51
142 0.58
143 0.66
144 0.67
145 0.73
146 0.81
147 0.87
148 0.89