Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4V5I8

Protein Details
Accession A0A2S4V5I8   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
103-127GPYIGRRKPFKGKIRQRNREDKVAQBasic
NLS Segment(s)
PositionSequence
108-120RRKPFKGKIRQRN
Subcellular Location(s) nucl 14, mito_nucl 10.833, cyto_nucl 10.333, mito 6.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037507  MrpL25  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
Amino Acid Sequences MESPVIKAQARAILSKPNFYDGSLTIPEFRQIKEDPVPKLIELFGGENRLSIKDKRLLGLYQPPKNITKPVTHHQVEHEEEEEETMDKQPRYSRASIVPNSFGPYIGRRKPFKGKIRQRNREDKVAQVSAKMNKMDDRVQSYRKVGMEIVKEKSKPSLPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.37
3 0.35
4 0.34
5 0.33
6 0.31
7 0.32
8 0.23
9 0.27
10 0.23
11 0.23
12 0.2
13 0.2
14 0.24
15 0.22
16 0.22
17 0.21
18 0.2
19 0.25
20 0.31
21 0.36
22 0.34
23 0.36
24 0.37
25 0.32
26 0.32
27 0.27
28 0.2
29 0.16
30 0.15
31 0.13
32 0.14
33 0.14
34 0.13
35 0.14
36 0.15
37 0.16
38 0.16
39 0.19
40 0.23
41 0.24
42 0.24
43 0.26
44 0.25
45 0.25
46 0.34
47 0.37
48 0.35
49 0.36
50 0.37
51 0.37
52 0.38
53 0.38
54 0.31
55 0.29
56 0.3
57 0.34
58 0.4
59 0.38
60 0.38
61 0.37
62 0.4
63 0.35
64 0.31
65 0.26
66 0.18
67 0.17
68 0.16
69 0.14
70 0.09
71 0.07
72 0.08
73 0.11
74 0.1
75 0.12
76 0.15
77 0.19
78 0.24
79 0.25
80 0.25
81 0.29
82 0.36
83 0.38
84 0.38
85 0.35
86 0.31
87 0.32
88 0.29
89 0.23
90 0.18
91 0.19
92 0.24
93 0.28
94 0.34
95 0.35
96 0.4
97 0.5
98 0.58
99 0.63
100 0.67
101 0.72
102 0.76
103 0.85
104 0.89
105 0.88
106 0.9
107 0.85
108 0.84
109 0.75
110 0.7
111 0.66
112 0.61
113 0.53
114 0.45
115 0.45
116 0.4
117 0.42
118 0.37
119 0.31
120 0.29
121 0.33
122 0.34
123 0.34
124 0.37
125 0.39
126 0.42
127 0.46
128 0.45
129 0.47
130 0.42
131 0.39
132 0.33
133 0.34
134 0.38
135 0.39
136 0.43
137 0.44
138 0.44
139 0.44
140 0.48