Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4VVQ7

Protein Details
Accession A0A2S4VVQ7   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
207-226ILLPQKKKLLRNNSKSISNNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 13.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036188  FAD/NAD-bd_sf  
Gene Ontology GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
Amino Acid Sequences MMILLTNTQISAKTDLSERALEMWDKSRVKHIEIVGRRGPLQVGVTTRELQELIGLRNVEIQIDRELLLEAAGRFAEPGALSRVANVMLKASKRPSLPTGSRTCTLRFLRIPLSLHGPSSASTHTSAPTEPIKSIEWQINELNYPLHRSPSGDYSSINSLSSQKSRLTTPQLLMKRIPINLIKISMKVIPPIVIVQVLNLRNLRPLILLPQKKKLLRNNSKSISNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.24
4 0.24
5 0.22
6 0.2
7 0.22
8 0.21
9 0.21
10 0.23
11 0.28
12 0.28
13 0.29
14 0.36
15 0.36
16 0.38
17 0.41
18 0.41
19 0.43
20 0.47
21 0.53
22 0.48
23 0.47
24 0.45
25 0.39
26 0.35
27 0.27
28 0.24
29 0.2
30 0.18
31 0.19
32 0.22
33 0.22
34 0.22
35 0.2
36 0.18
37 0.15
38 0.16
39 0.15
40 0.13
41 0.15
42 0.15
43 0.14
44 0.17
45 0.17
46 0.15
47 0.13
48 0.13
49 0.12
50 0.12
51 0.13
52 0.1
53 0.11
54 0.1
55 0.09
56 0.09
57 0.07
58 0.07
59 0.06
60 0.06
61 0.06
62 0.06
63 0.06
64 0.05
65 0.06
66 0.08
67 0.1
68 0.1
69 0.1
70 0.11
71 0.11
72 0.11
73 0.1
74 0.09
75 0.1
76 0.11
77 0.14
78 0.15
79 0.18
80 0.18
81 0.21
82 0.23
83 0.28
84 0.3
85 0.34
86 0.37
87 0.37
88 0.39
89 0.38
90 0.35
91 0.36
92 0.34
93 0.32
94 0.27
95 0.26
96 0.27
97 0.28
98 0.28
99 0.22
100 0.26
101 0.22
102 0.21
103 0.19
104 0.16
105 0.14
106 0.14
107 0.13
108 0.09
109 0.1
110 0.1
111 0.11
112 0.11
113 0.11
114 0.12
115 0.14
116 0.14
117 0.13
118 0.14
119 0.15
120 0.15
121 0.17
122 0.18
123 0.16
124 0.18
125 0.19
126 0.17
127 0.17
128 0.16
129 0.15
130 0.12
131 0.16
132 0.14
133 0.15
134 0.14
135 0.15
136 0.17
137 0.21
138 0.23
139 0.19
140 0.19
141 0.2
142 0.23
143 0.22
144 0.21
145 0.16
146 0.16
147 0.19
148 0.2
149 0.2
150 0.19
151 0.2
152 0.22
153 0.27
154 0.32
155 0.33
156 0.34
157 0.4
158 0.42
159 0.43
160 0.41
161 0.42
162 0.38
163 0.35
164 0.36
165 0.3
166 0.31
167 0.3
168 0.33
169 0.29
170 0.26
171 0.27
172 0.26
173 0.24
174 0.22
175 0.2
176 0.17
177 0.16
178 0.17
179 0.15
180 0.13
181 0.12
182 0.12
183 0.17
184 0.17
185 0.2
186 0.21
187 0.2
188 0.22
189 0.23
190 0.22
191 0.16
192 0.17
193 0.22
194 0.31
195 0.4
196 0.41
197 0.5
198 0.57
199 0.61
200 0.68
201 0.69
202 0.71
203 0.73
204 0.78
205 0.79
206 0.78