Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S4UPF8

Protein Details
Accession A0A2S4UPF8    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
95-117SHSTTVKPKAKHQKNVKLCFRLLHydrophilic
NLS Segment(s)
PositionSequence
87-93KRRRKSA
Subcellular Location(s) nucl 25.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MVNQAPSPRQTPSWPPSQQSTRITTPVRTNPNFVRPSQDSRKSLSQCNPPSQNPTNQNSEDESGDKDEPQSPGSHLSTQVSQSMNPKRRRKSASSHSTTVKPKAKHQKNVKLCFRLLLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.47
3 0.53
4 0.56
5 0.58
6 0.54
7 0.56
8 0.49
9 0.52
10 0.51
11 0.47
12 0.48
13 0.49
14 0.53
15 0.48
16 0.5
17 0.48
18 0.55
19 0.53
20 0.46
21 0.45
22 0.4
23 0.47
24 0.5
25 0.54
26 0.47
27 0.5
28 0.57
29 0.52
30 0.55
31 0.53
32 0.54
33 0.5
34 0.55
35 0.55
36 0.48
37 0.53
38 0.5
39 0.51
40 0.47
41 0.46
42 0.44
43 0.4
44 0.4
45 0.34
46 0.32
47 0.25
48 0.2
49 0.17
50 0.14
51 0.14
52 0.12
53 0.12
54 0.13
55 0.13
56 0.13
57 0.13
58 0.11
59 0.16
60 0.17
61 0.17
62 0.16
63 0.17
64 0.17
65 0.18
66 0.2
67 0.16
68 0.16
69 0.23
70 0.31
71 0.39
72 0.47
73 0.55
74 0.58
75 0.67
76 0.73
77 0.71
78 0.72
79 0.74
80 0.76
81 0.74
82 0.72
83 0.68
84 0.68
85 0.67
86 0.66
87 0.63
88 0.55
89 0.57
90 0.64
91 0.69
92 0.72
93 0.78
94 0.79
95 0.82
96 0.9
97 0.9
98 0.85
99 0.76