Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4WAV2

Protein Details
Accession A0A2S4WAV2   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
7-46NVLHKNHFRKDWQRRVKTWFDQPGAKKRRRNARQAKAAAAHydrophilic
190-209AGVWKVRKQKKEEEDAAKKKBasic
NLS Segment(s)
PositionSequence
30-43GAKKRRRNARQAKA
195-209VRKQKKEEEDAAKKK
Subcellular Location(s) mito 13, nucl 7.5, cyto_nucl 7.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001380  Ribosomal_L13e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01294  Ribosomal_L13e  
Amino Acid Sequences MGFRGNNVLHKNHFRKDWQRRVKTWFDQPGAKKRRRNARQAKAAAAGVRPTSLLRPAVRCQTVRYNRRVRSGRGFTSAELASAGIRRKEALSIGIPYDHRRRNKSEEGVSVNVDRLKAYKERLIIFPKNAKKPGKADSTDLSAPTTQDVSGPLPLPSGTKPEAPRAITSEELEFNAFKALRQARTTQRQAGVWKVRKQKKEEEDAAKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.66
3 0.73
4 0.77
5 0.77
6 0.8
7 0.8
8 0.82
9 0.83
10 0.79
11 0.78
12 0.76
13 0.69
14 0.69
15 0.7
16 0.73
17 0.73
18 0.74
19 0.71
20 0.7
21 0.76
22 0.77
23 0.8
24 0.81
25 0.81
26 0.84
27 0.82
28 0.77
29 0.69
30 0.63
31 0.53
32 0.43
33 0.35
34 0.24
35 0.2
36 0.17
37 0.14
38 0.13
39 0.14
40 0.17
41 0.18
42 0.22
43 0.25
44 0.32
45 0.35
46 0.34
47 0.36
48 0.42
49 0.49
50 0.52
51 0.58
52 0.6
53 0.61
54 0.69
55 0.7
56 0.65
57 0.65
58 0.65
59 0.58
60 0.54
61 0.51
62 0.42
63 0.41
64 0.35
65 0.25
66 0.18
67 0.15
68 0.1
69 0.11
70 0.13
71 0.1
72 0.1
73 0.1
74 0.1
75 0.11
76 0.11
77 0.11
78 0.11
79 0.11
80 0.12
81 0.13
82 0.13
83 0.16
84 0.23
85 0.26
86 0.3
87 0.32
88 0.37
89 0.43
90 0.49
91 0.51
92 0.48
93 0.46
94 0.46
95 0.43
96 0.39
97 0.32
98 0.26
99 0.22
100 0.18
101 0.13
102 0.1
103 0.11
104 0.12
105 0.14
106 0.16
107 0.19
108 0.21
109 0.25
110 0.32
111 0.32
112 0.34
113 0.4
114 0.44
115 0.47
116 0.52
117 0.51
118 0.48
119 0.49
120 0.52
121 0.52
122 0.47
123 0.44
124 0.39
125 0.41
126 0.38
127 0.34
128 0.29
129 0.21
130 0.19
131 0.16
132 0.15
133 0.09
134 0.09
135 0.1
136 0.1
137 0.12
138 0.12
139 0.11
140 0.11
141 0.11
142 0.13
143 0.12
144 0.15
145 0.15
146 0.2
147 0.22
148 0.29
149 0.34
150 0.34
151 0.35
152 0.34
153 0.36
154 0.32
155 0.31
156 0.27
157 0.23
158 0.22
159 0.21
160 0.18
161 0.14
162 0.17
163 0.16
164 0.13
165 0.2
166 0.25
167 0.28
168 0.31
169 0.38
170 0.43
171 0.53
172 0.59
173 0.57
174 0.56
175 0.56
176 0.56
177 0.6
178 0.61
179 0.6
180 0.62
181 0.66
182 0.71
183 0.74
184 0.77
185 0.78
186 0.76
187 0.78
188 0.79
189 0.79