Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4VNR6

Protein Details
Accession A0A2S4VNR6   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
171-218DYKKDDYKKEEHKKEEHKKEDYKKEEHKKEDKKDYKKEEDKKDYKEDDBasic
NLS Segment(s)
PositionSequence
149-208EEKKESYKKEEKKDYKDDDKKEDYKKDDYKKEEHKKEEHKKEDYKKEEHKKEDKKDYKKE
Subcellular Location(s) nucl 8.5, cyto_nucl 8.5, cyto 7.5, E.R. 5, extr 3
Family & Domain DBs
Amino Acid Sequences MFFSGLIDCPDILPFQSTEKVKMIVPSVITVAIGLCLGQAPLLASASGLSARQSPIDPQAMRGAALGRRSFFGKDEHDYGKDYYDSKKDYHHSEKKDYDHKYDKKEVSYKKEDDYSYYYGKDSGKKYDSEKKDYYKKDEEKKDYYKKDEEKKESYKKEEKKDYKDDDKKEDYKKDDYKKEEHKKEEHKKEDYKKEEHKKEDKKDYKKEEDKKDYKEDDHKDDYDNEHKKNDYTNNYAEDKGSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.21
4 0.22
5 0.25
6 0.27
7 0.28
8 0.27
9 0.3
10 0.29
11 0.25
12 0.24
13 0.21
14 0.19
15 0.18
16 0.16
17 0.13
18 0.1
19 0.08
20 0.06
21 0.05
22 0.04
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.05
29 0.06
30 0.06
31 0.05
32 0.06
33 0.06
34 0.07
35 0.06
36 0.06
37 0.08
38 0.09
39 0.1
40 0.11
41 0.12
42 0.17
43 0.24
44 0.23
45 0.23
46 0.27
47 0.26
48 0.26
49 0.24
50 0.22
51 0.17
52 0.22
53 0.21
54 0.17
55 0.18
56 0.2
57 0.2
58 0.19
59 0.21
60 0.2
61 0.23
62 0.27
63 0.28
64 0.28
65 0.3
66 0.29
67 0.26
68 0.23
69 0.21
70 0.2
71 0.22
72 0.23
73 0.21
74 0.26
75 0.28
76 0.34
77 0.43
78 0.48
79 0.48
80 0.54
81 0.59
82 0.59
83 0.64
84 0.59
85 0.57
86 0.59
87 0.59
88 0.58
89 0.61
90 0.57
91 0.55
92 0.59
93 0.57
94 0.55
95 0.58
96 0.53
97 0.46
98 0.49
99 0.43
100 0.39
101 0.38
102 0.33
103 0.27
104 0.26
105 0.23
106 0.21
107 0.22
108 0.24
109 0.21
110 0.23
111 0.23
112 0.24
113 0.29
114 0.36
115 0.39
116 0.42
117 0.44
118 0.46
119 0.53
120 0.54
121 0.57
122 0.57
123 0.6
124 0.62
125 0.67
126 0.67
127 0.66
128 0.72
129 0.74
130 0.7
131 0.68
132 0.67
133 0.65
134 0.68
135 0.7
136 0.67
137 0.66
138 0.7
139 0.74
140 0.71
141 0.72
142 0.72
143 0.71
144 0.73
145 0.76
146 0.75
147 0.74
148 0.78
149 0.77
150 0.79
151 0.79
152 0.75
153 0.72
154 0.71
155 0.7
156 0.68
157 0.67
158 0.61
159 0.61
160 0.65
161 0.66
162 0.67
163 0.65
164 0.66
165 0.7
166 0.76
167 0.76
168 0.75
169 0.75
170 0.78
171 0.83
172 0.85
173 0.82
174 0.8
175 0.81
176 0.84
177 0.85
178 0.82
179 0.8
180 0.79
181 0.82
182 0.82
183 0.82
184 0.83
185 0.83
186 0.85
187 0.87
188 0.87
189 0.86
190 0.87
191 0.87
192 0.88
193 0.88
194 0.88
195 0.87
196 0.88
197 0.86
198 0.83
199 0.83
200 0.78
201 0.74
202 0.75
203 0.7
204 0.67
205 0.66
206 0.6
207 0.54
208 0.52
209 0.51
210 0.52
211 0.52
212 0.47
213 0.46
214 0.46
215 0.44
216 0.49
217 0.51
218 0.48
219 0.48
220 0.5
221 0.51
222 0.52
223 0.51