Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S4UPN7

Protein Details
Accession A0A2S4UPN7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
86-105GPLHTYPKMNKKKHFDCPTNHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 6, E.R. 6, golg 5, mito 3, cyto 2, pero 2, vacu 2, mito_nucl 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences NYNPIMNSTTATLFEIITMLFIANIVGDVTASTCGVNFGTPRCSKTLDTNGHPIRMLINPCASYCLSSHRLTSSCYLNCTYIEQDGPLHTYPKMNKKKHFDCPTNYYPECCGVDNEAQKTYCVPADKDH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.08
4 0.07
5 0.07
6 0.05
7 0.04
8 0.04
9 0.04
10 0.04
11 0.04
12 0.04
13 0.03
14 0.03
15 0.03
16 0.04
17 0.05
18 0.05
19 0.05
20 0.05
21 0.05
22 0.06
23 0.07
24 0.07
25 0.08
26 0.15
27 0.17
28 0.19
29 0.2
30 0.23
31 0.24
32 0.3
33 0.38
34 0.36
35 0.38
36 0.46
37 0.45
38 0.43
39 0.42
40 0.34
41 0.27
42 0.25
43 0.23
44 0.15
45 0.15
46 0.15
47 0.15
48 0.17
49 0.15
50 0.13
51 0.12
52 0.15
53 0.18
54 0.18
55 0.18
56 0.18
57 0.19
58 0.2
59 0.22
60 0.22
61 0.19
62 0.2
63 0.21
64 0.2
65 0.19
66 0.2
67 0.18
68 0.14
69 0.13
70 0.12
71 0.11
72 0.11
73 0.14
74 0.13
75 0.13
76 0.12
77 0.17
78 0.22
79 0.32
80 0.41
81 0.46
82 0.53
83 0.62
84 0.7
85 0.76
86 0.8
87 0.77
88 0.74
89 0.76
90 0.74
91 0.73
92 0.65
93 0.57
94 0.49
95 0.46
96 0.41
97 0.33
98 0.28
99 0.24
100 0.3
101 0.34
102 0.35
103 0.34
104 0.33
105 0.32
106 0.31
107 0.29
108 0.26
109 0.25