Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S4VZN5

Protein Details
Accession A0A2S4VZN5    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
59-78VWVNRRKVLHIEKQSRKDHEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 8.5, cyto_nucl 8.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
IPR001163  Sm_dom_euk/arc  
IPR027078  snRNP-E  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005681  C:spliceosomal complex  
GO:0005685  C:U1 snRNP  
GO:0005686  C:U2 snRNP  
GO:0005687  C:U4 snRNP  
GO:0046540  C:U4/U6 x U5 tri-snRNP complex  
GO:0005682  C:U5 snRNP  
GO:0003723  F:RNA binding  
GO:0006364  P:rRNA processing  
GO:0000387  P:spliceosomal snRNP assembly  
Pfam View protein in Pfam  
PF01423  LSM  
CDD cd01718  Sm_E  
Amino Acid Sequences MSGRQQRVMVQPINVIFKHLQAGQLVHIWLYDNTEFRLEGKIIGFDEFMNVVLDNASEVWVNRRKVLHIEKQSRKDHESL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.31
3 0.24
4 0.22
5 0.24
6 0.2
7 0.19
8 0.16
9 0.17
10 0.14
11 0.16
12 0.15
13 0.12
14 0.11
15 0.11
16 0.09
17 0.11
18 0.11
19 0.1
20 0.11
21 0.11
22 0.11
23 0.11
24 0.13
25 0.1
26 0.1
27 0.09
28 0.09
29 0.09
30 0.09
31 0.09
32 0.07
33 0.07
34 0.07
35 0.07
36 0.06
37 0.06
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.12
47 0.19
48 0.2
49 0.24
50 0.25
51 0.26
52 0.35
53 0.44
54 0.47
55 0.51
56 0.61
57 0.67
58 0.75
59 0.81
60 0.79