Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4URM1

Protein Details
Accession A0A2S4URM1    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
20-43TITPTPPPASKKKKPIPWEKDAVEHydrophilic
275-298RLDSEDRRERKRMKIETRRCGTTQBasic
NLS Segment(s)
PositionSequence
31-32KK
Subcellular Location(s) nucl 15.5, mito 10.5, cyto_nucl 8.833, cyto_mito 6.333
Family & Domain DBs
Amino Acid Sequences MPPRKKKSSTATSAALGTPTITPTPPPASKKKKPIPWEKDAVEPGFSSMRILLDWIQEPGHFKKWRGKKGSGVSKEVLANEIVQELADKGIHHRIPRDIRTKITELQNSFTSTCDWIRNTGQGLLAEDAANGTTNIRDIVIKRFKYYYDLEEVMGEQDNANPRDTVDSTSELVPNLLADHDPNLAQERHPDPLLSSLTGNDFELEDSETDGPPRPTPGDNGTSSPAPEGAAKAGSRSKSNSKKASLPQGLEKAISDTYEYRYKSLTSKENQEKNRLDSEDRRERKRMKIETRRCGTTQKC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.4
3 0.29
4 0.22
5 0.16
6 0.14
7 0.13
8 0.12
9 0.12
10 0.17
11 0.24
12 0.29
13 0.35
14 0.44
15 0.53
16 0.62
17 0.72
18 0.77
19 0.78
20 0.82
21 0.87
22 0.85
23 0.84
24 0.83
25 0.75
26 0.73
27 0.69
28 0.6
29 0.5
30 0.41
31 0.35
32 0.27
33 0.25
34 0.18
35 0.13
36 0.12
37 0.11
38 0.12
39 0.11
40 0.13
41 0.14
42 0.14
43 0.14
44 0.14
45 0.19
46 0.22
47 0.29
48 0.29
49 0.3
50 0.39
51 0.48
52 0.57
53 0.6
54 0.61
55 0.61
56 0.68
57 0.76
58 0.72
59 0.68
60 0.59
61 0.55
62 0.52
63 0.43
64 0.34
65 0.23
66 0.18
67 0.13
68 0.12
69 0.08
70 0.06
71 0.06
72 0.05
73 0.06
74 0.06
75 0.06
76 0.08
77 0.15
78 0.18
79 0.19
80 0.21
81 0.28
82 0.35
83 0.42
84 0.48
85 0.43
86 0.45
87 0.48
88 0.49
89 0.47
90 0.47
91 0.45
92 0.39
93 0.4
94 0.38
95 0.35
96 0.32
97 0.27
98 0.21
99 0.18
100 0.18
101 0.18
102 0.16
103 0.17
104 0.18
105 0.2
106 0.19
107 0.19
108 0.18
109 0.15
110 0.16
111 0.13
112 0.13
113 0.1
114 0.09
115 0.08
116 0.06
117 0.06
118 0.05
119 0.04
120 0.04
121 0.04
122 0.04
123 0.05
124 0.06
125 0.07
126 0.16
127 0.23
128 0.24
129 0.25
130 0.26
131 0.26
132 0.29
133 0.3
134 0.23
135 0.21
136 0.21
137 0.19
138 0.19
139 0.18
140 0.15
141 0.13
142 0.11
143 0.06
144 0.07
145 0.11
146 0.12
147 0.13
148 0.12
149 0.12
150 0.14
151 0.15
152 0.16
153 0.13
154 0.14
155 0.15
156 0.16
157 0.16
158 0.14
159 0.13
160 0.1
161 0.08
162 0.06
163 0.06
164 0.05
165 0.04
166 0.05
167 0.06
168 0.06
169 0.07
170 0.1
171 0.1
172 0.1
173 0.15
174 0.16
175 0.18
176 0.18
177 0.18
178 0.15
179 0.19
180 0.2
181 0.16
182 0.14
183 0.13
184 0.14
185 0.14
186 0.14
187 0.09
188 0.08
189 0.07
190 0.08
191 0.08
192 0.07
193 0.08
194 0.09
195 0.09
196 0.1
197 0.13
198 0.13
199 0.13
200 0.15
201 0.16
202 0.16
203 0.2
204 0.23
205 0.26
206 0.26
207 0.28
208 0.29
209 0.27
210 0.26
211 0.23
212 0.18
213 0.14
214 0.13
215 0.11
216 0.1
217 0.12
218 0.11
219 0.14
220 0.18
221 0.19
222 0.21
223 0.25
224 0.34
225 0.41
226 0.51
227 0.55
228 0.55
229 0.61
230 0.66
231 0.71
232 0.67
233 0.61
234 0.59
235 0.58
236 0.54
237 0.47
238 0.4
239 0.32
240 0.26
241 0.23
242 0.18
243 0.15
244 0.18
245 0.24
246 0.25
247 0.23
248 0.25
249 0.26
250 0.29
251 0.34
252 0.38
253 0.38
254 0.48
255 0.57
256 0.64
257 0.68
258 0.72
259 0.71
260 0.67
261 0.69
262 0.62
263 0.58
264 0.58
265 0.62
266 0.64
267 0.66
268 0.68
269 0.69
270 0.72
271 0.75
272 0.77
273 0.77
274 0.78
275 0.82
276 0.85
277 0.87
278 0.88
279 0.84
280 0.76