Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4VZZ8

Protein Details
Accession A0A2S4VZZ8   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
92-115PSSSNSGTNNTQKKKKRKRNRLRIHydrophilic
NLS Segment(s)
PositionSequence
104-115KKKKRKRNRLRI
Subcellular Location(s) nucl 14, mito_nucl 13.833, mito 12.5, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR033695  POLO_box_2  
IPR000959  POLO_box_dom  
IPR036947  POLO_box_dom_sf  
Gene Ontology GO:0005524  F:ATP binding  
Pfam View protein in Pfam  
PF00659  POLO_box  
PROSITE View protein in PROSITE  
PS50078  POLO_BOX  
CDD cd13117  POLO_box_2  
Amino Acid Sequences MFTTLKRNVKWAYRDLNRIKHLDFVVKYYRMNNAIVFKMSNDLIQINFWDHQKLLLTDNARKITLIEPDLNLKTYYIGELFKEAYELGLFKPSSSNSGTNNTQKKKKRKRNRLRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.67
3 0.7
4 0.67
5 0.65
6 0.58
7 0.53
8 0.48
9 0.46
10 0.38
11 0.34
12 0.36
13 0.34
14 0.34
15 0.3
16 0.33
17 0.28
18 0.28
19 0.26
20 0.23
21 0.23
22 0.23
23 0.21
24 0.17
25 0.17
26 0.16
27 0.13
28 0.1
29 0.1
30 0.09
31 0.09
32 0.09
33 0.09
34 0.1
35 0.1
36 0.1
37 0.1
38 0.1
39 0.11
40 0.11
41 0.11
42 0.13
43 0.15
44 0.17
45 0.22
46 0.22
47 0.21
48 0.2
49 0.19
50 0.18
51 0.19
52 0.18
53 0.14
54 0.14
55 0.18
56 0.18
57 0.18
58 0.16
59 0.13
60 0.12
61 0.11
62 0.11
63 0.09
64 0.09
65 0.08
66 0.1
67 0.1
68 0.09
69 0.1
70 0.09
71 0.08
72 0.08
73 0.08
74 0.07
75 0.12
76 0.12
77 0.12
78 0.15
79 0.15
80 0.18
81 0.21
82 0.24
83 0.21
84 0.28
85 0.34
86 0.4
87 0.49
88 0.54
89 0.6
90 0.67
91 0.75
92 0.8
93 0.85
94 0.88
95 0.9