Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S4W051

Protein Details
Accession A0A2S4W051    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
184-213GLRLGRFSPERREKKKKSRFRLQVRNFLKFHydrophilic
NLS Segment(s)
PositionSequence
192-204PERREKKKKSRFR
Subcellular Location(s) nucl 16.5, mito_nucl 11.666, cyto_nucl 10.833, mito 5.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MDTQSSKLSCFQDNGKPPTDRRRLNIPFSNILPKSTSPLCRSIYSLTQTLLDLNLKITSEEWKLGPSLEKLNTVSSLPDSILLHPLDSIPRTALNSASEKIPPIHRLIFLEDLELSNFPGWTFAWDQPWESRWNQLLSRFILKHWQHALQAGSFKSFHMDPSESSDPIIQSGIIHCWLFGQEEGLRLGRFSPERREKKKKSRFRLQVRNFLKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.51
3 0.52
4 0.54
5 0.62
6 0.66
7 0.62
8 0.58
9 0.64
10 0.64
11 0.68
12 0.71
13 0.66
14 0.61
15 0.59
16 0.63
17 0.53
18 0.47
19 0.41
20 0.34
21 0.33
22 0.34
23 0.37
24 0.31
25 0.37
26 0.38
27 0.37
28 0.39
29 0.38
30 0.38
31 0.35
32 0.33
33 0.28
34 0.25
35 0.24
36 0.22
37 0.19
38 0.15
39 0.11
40 0.1
41 0.11
42 0.1
43 0.1
44 0.1
45 0.12
46 0.13
47 0.14
48 0.13
49 0.13
50 0.13
51 0.14
52 0.16
53 0.14
54 0.17
55 0.17
56 0.19
57 0.19
58 0.2
59 0.2
60 0.18
61 0.17
62 0.12
63 0.12
64 0.09
65 0.11
66 0.1
67 0.1
68 0.13
69 0.13
70 0.12
71 0.11
72 0.11
73 0.11
74 0.1
75 0.1
76 0.07
77 0.08
78 0.09
79 0.09
80 0.1
81 0.11
82 0.12
83 0.13
84 0.13
85 0.13
86 0.13
87 0.14
88 0.15
89 0.15
90 0.15
91 0.16
92 0.16
93 0.16
94 0.18
95 0.19
96 0.16
97 0.15
98 0.13
99 0.11
100 0.11
101 0.1
102 0.08
103 0.06
104 0.06
105 0.05
106 0.05
107 0.05
108 0.07
109 0.1
110 0.11
111 0.14
112 0.15
113 0.16
114 0.17
115 0.19
116 0.2
117 0.18
118 0.21
119 0.21
120 0.23
121 0.24
122 0.26
123 0.28
124 0.27
125 0.32
126 0.28
127 0.26
128 0.33
129 0.32
130 0.35
131 0.34
132 0.34
133 0.29
134 0.32
135 0.33
136 0.25
137 0.28
138 0.22
139 0.21
140 0.18
141 0.17
142 0.17
143 0.16
144 0.15
145 0.16
146 0.17
147 0.15
148 0.24
149 0.27
150 0.24
151 0.25
152 0.25
153 0.21
154 0.2
155 0.2
156 0.11
157 0.08
158 0.1
159 0.11
160 0.12
161 0.11
162 0.1
163 0.1
164 0.11
165 0.12
166 0.11
167 0.12
168 0.11
169 0.13
170 0.15
171 0.17
172 0.16
173 0.15
174 0.16
175 0.18
176 0.22
177 0.24
178 0.33
179 0.42
180 0.53
181 0.63
182 0.73
183 0.78
184 0.85
185 0.92
186 0.92
187 0.92
188 0.92
189 0.93
190 0.93
191 0.94
192 0.92
193 0.92