Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4UVS3

Protein Details
Accession A0A2S4UVS3    Localization Confidence High Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
184-210QLELKDKRTTRKPKSLSNKQKLKIQRGHydrophilic
214-239SDKLLNKSSKKHARKENRDAAKKIYEHydrophilic
NLS Segment(s)
PositionSequence
190-236KRTTRKPKSLSNKQKLKIQRGVEISDKLLNKSSKKHARKENRDAAKK
Subcellular Location(s) nucl 19, cyto 7
Family & Domain DBs
Amino Acid Sequences PDSEEKLGSPSGSKASSKSENPETASGLVSGSISLSDSGDTEIASGLVTSLQSVSVTLDAWPRTGNMMHYRELKILEVKKTYDSKSRKEAPDRSFDTSISPLLCEPLSGNPSRHVGAMVTARAIPAVQATFQPLSVKSYIPGHGRSKEKTHPRAEPMQHVIPHEPPTEEDLRSQTPTSTTNSRQLELKDKRTTRKPKSLSNKQKLKIQRGVEISDKLLNKSSKKHARKENRDAAKKIYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.28
3 0.34
4 0.36
5 0.41
6 0.44
7 0.45
8 0.48
9 0.48
10 0.43
11 0.37
12 0.34
13 0.27
14 0.2
15 0.16
16 0.12
17 0.1
18 0.07
19 0.06
20 0.06
21 0.06
22 0.06
23 0.06
24 0.06
25 0.07
26 0.07
27 0.07
28 0.07
29 0.06
30 0.06
31 0.06
32 0.05
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.05
39 0.05
40 0.05
41 0.06
42 0.06
43 0.06
44 0.07
45 0.11
46 0.11
47 0.12
48 0.12
49 0.11
50 0.13
51 0.13
52 0.16
53 0.21
54 0.23
55 0.26
56 0.3
57 0.31
58 0.31
59 0.31
60 0.29
61 0.27
62 0.28
63 0.29
64 0.27
65 0.27
66 0.3
67 0.34
68 0.35
69 0.38
70 0.39
71 0.4
72 0.46
73 0.53
74 0.54
75 0.59
76 0.65
77 0.59
78 0.63
79 0.62
80 0.59
81 0.52
82 0.46
83 0.4
84 0.32
85 0.3
86 0.2
87 0.16
88 0.11
89 0.11
90 0.1
91 0.08
92 0.07
93 0.09
94 0.11
95 0.12
96 0.13
97 0.14
98 0.16
99 0.16
100 0.16
101 0.13
102 0.1
103 0.11
104 0.12
105 0.1
106 0.09
107 0.08
108 0.08
109 0.08
110 0.07
111 0.05
112 0.04
113 0.04
114 0.04
115 0.05
116 0.07
117 0.07
118 0.08
119 0.09
120 0.08
121 0.11
122 0.11
123 0.11
124 0.1
125 0.13
126 0.16
127 0.18
128 0.23
129 0.24
130 0.29
131 0.33
132 0.35
133 0.38
134 0.43
135 0.5
136 0.53
137 0.55
138 0.54
139 0.55
140 0.62
141 0.59
142 0.57
143 0.53
144 0.5
145 0.46
146 0.43
147 0.39
148 0.33
149 0.34
150 0.28
151 0.23
152 0.19
153 0.22
154 0.23
155 0.22
156 0.21
157 0.21
158 0.22
159 0.24
160 0.24
161 0.19
162 0.18
163 0.2
164 0.23
165 0.26
166 0.27
167 0.33
168 0.35
169 0.35
170 0.37
171 0.38
172 0.44
173 0.45
174 0.5
175 0.51
176 0.54
177 0.62
178 0.69
179 0.77
180 0.75
181 0.79
182 0.76
183 0.77
184 0.82
185 0.86
186 0.87
187 0.87
188 0.87
189 0.8
190 0.82
191 0.81
192 0.79
193 0.76
194 0.69
195 0.65
196 0.6
197 0.6
198 0.57
199 0.5
200 0.43
201 0.41
202 0.38
203 0.32
204 0.35
205 0.36
206 0.35
207 0.4
208 0.49
209 0.54
210 0.62
211 0.69
212 0.73
213 0.79
214 0.86
215 0.9
216 0.9
217 0.9
218 0.9
219 0.84