Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4VAB9

Protein Details
Accession A0A2S4VAB9   
Localization Confidence Low
Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
44-73GVVLRDRRKKNPRSSNFQCRHHKRRAAPTDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 7
Family & Domain DBs
Amino Acid Sequences YPRIRHHLTTNPIAYKGLVHPNRSFSLARIAQSRPRFNHELVAGVVLRDRRKKNPRSSNFQCRHHKRRAAPTDLEFHKPIDDLNKPTAVLKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.33
3 0.31
4 0.33
5 0.31
6 0.32
7 0.34
8 0.37
9 0.39
10 0.4
11 0.36
12 0.26
13 0.31
14 0.29
15 0.29
16 0.28
17 0.29
18 0.33
19 0.39
20 0.44
21 0.38
22 0.42
23 0.44
24 0.4
25 0.43
26 0.36
27 0.31
28 0.24
29 0.24
30 0.17
31 0.13
32 0.14
33 0.12
34 0.14
35 0.19
36 0.22
37 0.3
38 0.4
39 0.49
40 0.58
41 0.67
42 0.71
43 0.75
44 0.81
45 0.83
46 0.81
47 0.82
48 0.82
49 0.81
50 0.82
51 0.81
52 0.81
53 0.77
54 0.8
55 0.79
56 0.76
57 0.72
58 0.67
59 0.66
60 0.61
61 0.58
62 0.48
63 0.4
64 0.34
65 0.29
66 0.27
67 0.25
68 0.27
69 0.26
70 0.3
71 0.31
72 0.3