Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J4IB35

Protein Details
Accession J4IB35   
Localization Confidence Low
Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
174-193NTNAPAPKSKTNRRLKTDIPHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11cyto_nucl 11, nucl 9, cysk 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR016192  APOBEC/CMP_deaminase_Zn-bd  
IPR002125  CMP_dCMP_dom  
IPR016193  Cytidine_deaminase-like  
IPR028883  tRNA_aden_deaminase  
Gene Ontology GO:0008251  F:tRNA-specific adenosine deaminase activity  
GO:0008270  F:zinc ion binding  
GO:0002100  P:tRNA wobble adenosine to inosine editing  
Pfam View protein in Pfam  
PF14437  MafB19-deam  
PROSITE View protein in PROSITE  
PS00903  CYT_DCMP_DEAMINASES_1  
PS51747  CYT_DCMP_DEAMINASES_2  
CDD cd01285  nucleoside_deaminase  
Amino Acid Sequences MSTGSQSNTPTYSEADKTPEHLEWMRKAMSMAEEALTAGEVPVGCIFVRNGKVVAQARNRTNELRNATRHAELEAIDEILADKTLTPAVTPYPLAETTLYVTVEPCIMCASALRQMGIKEVFYGCENDRFGGCGSVLGVNSGLPHPKHPAYRATGGYFREEAIMVLRRFYITENTNAPAPKSKTNRRLKTDIPSRSSHLGGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.26
4 0.27
5 0.3
6 0.27
7 0.28
8 0.3
9 0.33
10 0.32
11 0.36
12 0.34
13 0.31
14 0.3
15 0.27
16 0.24
17 0.21
18 0.18
19 0.14
20 0.12
21 0.12
22 0.11
23 0.1
24 0.07
25 0.05
26 0.06
27 0.05
28 0.05
29 0.06
30 0.06
31 0.06
32 0.07
33 0.08
34 0.12
35 0.14
36 0.15
37 0.15
38 0.15
39 0.22
40 0.25
41 0.32
42 0.35
43 0.4
44 0.43
45 0.47
46 0.49
47 0.45
48 0.45
49 0.44
50 0.43
51 0.42
52 0.41
53 0.41
54 0.41
55 0.39
56 0.36
57 0.3
58 0.25
59 0.19
60 0.18
61 0.14
62 0.11
63 0.09
64 0.08
65 0.08
66 0.07
67 0.07
68 0.04
69 0.04
70 0.04
71 0.05
72 0.05
73 0.04
74 0.05
75 0.06
76 0.07
77 0.07
78 0.07
79 0.08
80 0.09
81 0.09
82 0.09
83 0.09
84 0.09
85 0.1
86 0.1
87 0.07
88 0.07
89 0.07
90 0.08
91 0.07
92 0.06
93 0.05
94 0.05
95 0.05
96 0.05
97 0.06
98 0.1
99 0.1
100 0.11
101 0.11
102 0.11
103 0.14
104 0.15
105 0.13
106 0.1
107 0.1
108 0.11
109 0.1
110 0.13
111 0.11
112 0.15
113 0.15
114 0.15
115 0.15
116 0.15
117 0.15
118 0.13
119 0.12
120 0.08
121 0.08
122 0.09
123 0.09
124 0.08
125 0.07
126 0.06
127 0.07
128 0.08
129 0.11
130 0.1
131 0.12
132 0.17
133 0.21
134 0.24
135 0.26
136 0.31
137 0.33
138 0.38
139 0.4
140 0.38
141 0.39
142 0.37
143 0.38
144 0.33
145 0.27
146 0.23
147 0.19
148 0.16
149 0.16
150 0.21
151 0.18
152 0.18
153 0.18
154 0.17
155 0.18
156 0.2
157 0.22
158 0.17
159 0.22
160 0.24
161 0.26
162 0.29
163 0.29
164 0.3
165 0.32
166 0.33
167 0.38
168 0.44
169 0.53
170 0.6
171 0.7
172 0.78
173 0.78
174 0.81
175 0.78
176 0.79
177 0.79
178 0.78
179 0.72
180 0.67
181 0.64
182 0.61