Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S7R588

Protein Details
Accession A0A2S7R588   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
165-189ARTNLRRRVKVLRKRGERRRLDCIQBasic
NLS Segment(s)
PositionSequence
170-184RRRVKVLRKRGERRR
Subcellular Location(s) mito 18, cyto 5.5, cyto_nucl 5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF13384  HTH_23  
Amino Acid Sequences MGRVYPQYRTPTKSRFFYLLERGQTAPAAAKELGIDRTTAWRWTKRFCPSEPERTTRRRLATKKLGRLYTIIDEHINQMIQWITGHYDRRILSLEMIVQEACGIKATYHTLLRAWQRWGYHYHPPDSKPFLSAAQKLARYTFAVKHWDRPAGYWRKGIYTDETVARTNLRRRVKVLRKRGERRRLDCIQFTFNSGRDSIMCWAAIGYNFKSELYFVSTEGQGKGFTQKKYEQQILRGPLAGIFRDRYLQGFFLQDFNKFIDSIPERICKVLARRGAQTPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.58
3 0.56
4 0.58
5 0.59
6 0.57
7 0.53
8 0.5
9 0.47
10 0.42
11 0.38
12 0.31
13 0.26
14 0.19
15 0.19
16 0.16
17 0.16
18 0.16
19 0.18
20 0.2
21 0.16
22 0.16
23 0.13
24 0.19
25 0.21
26 0.26
27 0.29
28 0.34
29 0.37
30 0.44
31 0.51
32 0.54
33 0.59
34 0.55
35 0.59
36 0.59
37 0.66
38 0.66
39 0.65
40 0.63
41 0.64
42 0.69
43 0.66
44 0.66
45 0.65
46 0.65
47 0.68
48 0.72
49 0.74
50 0.77
51 0.76
52 0.71
53 0.62
54 0.58
55 0.51
56 0.46
57 0.38
58 0.3
59 0.23
60 0.22
61 0.22
62 0.21
63 0.18
64 0.11
65 0.11
66 0.1
67 0.09
68 0.09
69 0.08
70 0.09
71 0.13
72 0.16
73 0.15
74 0.19
75 0.19
76 0.21
77 0.23
78 0.21
79 0.18
80 0.16
81 0.17
82 0.13
83 0.14
84 0.12
85 0.09
86 0.09
87 0.08
88 0.07
89 0.06
90 0.06
91 0.05
92 0.07
93 0.09
94 0.11
95 0.12
96 0.12
97 0.12
98 0.17
99 0.21
100 0.23
101 0.23
102 0.23
103 0.23
104 0.25
105 0.29
106 0.29
107 0.33
108 0.33
109 0.35
110 0.36
111 0.37
112 0.4
113 0.41
114 0.37
115 0.29
116 0.27
117 0.26
118 0.26
119 0.26
120 0.25
121 0.24
122 0.25
123 0.24
124 0.24
125 0.21
126 0.18
127 0.19
128 0.17
129 0.16
130 0.23
131 0.23
132 0.29
133 0.3
134 0.32
135 0.3
136 0.29
137 0.36
138 0.36
139 0.38
140 0.36
141 0.34
142 0.33
143 0.34
144 0.33
145 0.28
146 0.22
147 0.22
148 0.2
149 0.22
150 0.2
151 0.19
152 0.2
153 0.2
154 0.23
155 0.29
156 0.33
157 0.33
158 0.37
159 0.47
160 0.56
161 0.61
162 0.67
163 0.69
164 0.73
165 0.82
166 0.88
167 0.88
168 0.87
169 0.82
170 0.8
171 0.78
172 0.72
173 0.67
174 0.6
175 0.55
176 0.46
177 0.44
178 0.38
179 0.32
180 0.29
181 0.23
182 0.21
183 0.16
184 0.17
185 0.15
186 0.14
187 0.12
188 0.11
189 0.11
190 0.11
191 0.12
192 0.13
193 0.12
194 0.13
195 0.13
196 0.14
197 0.14
198 0.13
199 0.12
200 0.14
201 0.14
202 0.13
203 0.15
204 0.16
205 0.18
206 0.18
207 0.17
208 0.13
209 0.13
210 0.21
211 0.24
212 0.25
213 0.29
214 0.34
215 0.41
216 0.48
217 0.56
218 0.51
219 0.52
220 0.58
221 0.58
222 0.54
223 0.47
224 0.39
225 0.34
226 0.32
227 0.27
228 0.22
229 0.18
230 0.18
231 0.19
232 0.2
233 0.19
234 0.19
235 0.2
236 0.18
237 0.2
238 0.2
239 0.23
240 0.24
241 0.23
242 0.22
243 0.23
244 0.23
245 0.2
246 0.19
247 0.23
248 0.25
249 0.29
250 0.32
251 0.35
252 0.35
253 0.36
254 0.37
255 0.33
256 0.36
257 0.39
258 0.42
259 0.41
260 0.45