FuNGI

J7RG92

Protein Details

Accession

J7RG92

Localization Confidence

Medium

Confidence Score

12.6

NoLS Segment(s)

Position	Sequence	Protein Nature
353-373	LAAPRARKKRKLVVSGIRPED	Hydrophilic

NLS Segment(s)

Position	Sequence
356-363	PRARKKRK

Subcellular Location(s)

nucl 15.5, cyto_nucl 9.5, mito 9

Family & Domain DBs

Amino Acid Sequences

MDPVRTSIPRRPPSSPASISITASVVDRNASAMNCAVGTHLRRKSSRIEKWLDEQHRMSGDEKSVHIPANEQSVPSGDAKRSPCLAYPRLPPASLRKDHDDQSTLNSYVLIDDAQRVSQDAPQGPPSDATPHASPPSTPRKTSPFRSAQGVFQSSSPLRGFHLSFGSRRPSTSSNTTRSQTPISQATSPPPHNDPPGGHSRSSSLATMYTKPDRTASPSLATSRQRSLSSWKLRRPSTTEQRQPTLLSSDAYTLAPPRPSMSSSITHSSSASIPPSSIDTPSGSRKTHFGQARPQSPALFSASSPSLWSLPTNASHMYDPPDSTKVIARDKAVRIPLSLKMPAGNGAGLSSALAAPRARKKRKLVVSGIRPEDDYRFEAIKKWCESFGELASISRVASGDIHVDFRKAEVAETVCRLQARVHIIGVGSVRLSYFTGKKP

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.67
2	0.62
3	0.56
4	0.54
5	0.51
6	0.47
7	0.42
8	0.36
9	0.26
10	0.24
11	0.2
12	0.13
13	0.12
14	0.11
15	0.11
16	0.12
17	0.12
18	0.13
19	0.13
20	0.13
21	0.12
22	0.12
23	0.12
24	0.15
25	0.2
26	0.27
27	0.32
28	0.38
29	0.4
30	0.44
31	0.52
32	0.58
33	0.63
34	0.63
35	0.65
36	0.63
37	0.69
38	0.76
39	0.71
40	0.67
41	0.59
42	0.54
43	0.5
44	0.47
45	0.4
46	0.34
47	0.33
48	0.29
49	0.29
50	0.28
51	0.27
52	0.27
53	0.26
54	0.24
55	0.21
56	0.26
57	0.25
58	0.22
59	0.2
60	0.2
61	0.22
62	0.22
63	0.24
64	0.17
65	0.23
66	0.26
67	0.29
68	0.3
69	0.29
70	0.32
71	0.36
72	0.4
73	0.39
74	0.43
75	0.47
76	0.47
77	0.46
78	0.44
79	0.46
80	0.51
81	0.5
82	0.49
83	0.48
84	0.49
85	0.53
86	0.54
87	0.48
88	0.39
89	0.39
90	0.39
91	0.33
92	0.29
93	0.25
94	0.2
95	0.17
96	0.16
97	0.11
98	0.06
99	0.08
100	0.08
101	0.09
102	0.09
103	0.1
104	0.1
105	0.12
106	0.17
107	0.17
108	0.18
109	0.21
110	0.23
111	0.22
112	0.22
113	0.21
114	0.2
115	0.18
116	0.2
117	0.18
118	0.19
119	0.21
120	0.21
121	0.2
122	0.24
123	0.33
124	0.34
125	0.34
126	0.35
127	0.42
128	0.48
129	0.54
130	0.56
131	0.53
132	0.51
133	0.56
134	0.54
135	0.49
136	0.48
137	0.44
138	0.35
139	0.27
140	0.29
141	0.23
142	0.25
143	0.22
144	0.16
145	0.15
146	0.18
147	0.18
148	0.15
149	0.21
150	0.19
151	0.2
152	0.23
153	0.28
154	0.25
155	0.25
156	0.28
157	0.25
158	0.28
159	0.36
160	0.4
161	0.39
162	0.43
163	0.44
164	0.41
165	0.41
166	0.39
167	0.32
168	0.28
169	0.27
170	0.25
171	0.26
172	0.25
173	0.27
174	0.3
175	0.29
176	0.29
177	0.28
178	0.28
179	0.27
180	0.28
181	0.24
182	0.22
183	0.3
184	0.3
185	0.26
186	0.25
187	0.25
188	0.25
189	0.25
190	0.21
191	0.13
192	0.12
193	0.14
194	0.16
195	0.18
196	0.19
197	0.19
198	0.19
199	0.2
200	0.19
201	0.23
202	0.24
203	0.23
204	0.21
205	0.22
206	0.23
207	0.27
208	0.29
209	0.25
210	0.25
211	0.25
212	0.24
213	0.24
214	0.28
215	0.32
216	0.4
217	0.44
218	0.47
219	0.51
220	0.52
221	0.54
222	0.55
223	0.55
224	0.55
225	0.59
226	0.61
227	0.59
228	0.59
229	0.57
230	0.51
231	0.42
232	0.34
233	0.25
234	0.17
235	0.14
236	0.13
237	0.13
238	0.12
239	0.11
240	0.1
241	0.11
242	0.11
243	0.11
244	0.11
245	0.12
246	0.13
247	0.16
248	0.17
249	0.18
250	0.21
251	0.25
252	0.24
253	0.24
254	0.23
255	0.21
256	0.19
257	0.17
258	0.15
259	0.11
260	0.1
261	0.1
262	0.13
263	0.13
264	0.12
265	0.12
266	0.12
267	0.15
268	0.22
269	0.25
270	0.23
271	0.23
272	0.26
273	0.27
274	0.34
275	0.35
276	0.33
277	0.38
278	0.46
279	0.51
280	0.52
281	0.5
282	0.42
283	0.39
284	0.37
285	0.3
286	0.23
287	0.17
288	0.16
289	0.16
290	0.15
291	0.15
292	0.14
293	0.11
294	0.11
295	0.12
296	0.1
297	0.12
298	0.13
299	0.15
300	0.15
301	0.16
302	0.16
303	0.18
304	0.2
305	0.19
306	0.19
307	0.2
308	0.2
309	0.19
310	0.19
311	0.22
312	0.23
313	0.27
314	0.29
315	0.29
316	0.35
317	0.38
318	0.42
319	0.42
320	0.38
321	0.34
322	0.34
323	0.35
324	0.32
325	0.31
326	0.26
327	0.22
328	0.22
329	0.23
330	0.21
331	0.16
332	0.12
333	0.1
334	0.1
335	0.08
336	0.08
337	0.06
338	0.05
339	0.05
340	0.07
341	0.08
342	0.14
343	0.24
344	0.34
345	0.42
346	0.49
347	0.58
348	0.66
349	0.75
350	0.79
351	0.79
352	0.79
353	0.81
354	0.82
355	0.78
356	0.69
357	0.61
358	0.53
359	0.46
360	0.4
361	0.32
362	0.27
363	0.25
364	0.24
365	0.3
366	0.34
367	0.39
368	0.39
369	0.39
370	0.37
371	0.36
372	0.39
373	0.36
374	0.32
375	0.28
376	0.25
377	0.23
378	0.22
379	0.2
380	0.17
381	0.14
382	0.12
383	0.09
384	0.09
385	0.1
386	0.12
387	0.13
388	0.17
389	0.17
390	0.18
391	0.17
392	0.17
393	0.2
394	0.17
395	0.17
396	0.17
397	0.2
398	0.23
399	0.27
400	0.28
401	0.26
402	0.26
403	0.26
404	0.23
405	0.25
406	0.28
407	0.27
408	0.26
409	0.25
410	0.25
411	0.27
412	0.26
413	0.21
414	0.14
415	0.12
416	0.12
417	0.11
418	0.12
419	0.15

J7RG92

3D AlphaFold-predicted Structure Viewer