Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J4HYW3

Protein Details
Accession J4HYW3    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
4-38ETTKSTKRKAADKAEKAPKAKAKKDPKAPKRALSAHydrophilic
NLS Segment(s)
PositionSequence
8-34STKRKAADKAEKAPKAKAKKDPKAPKR
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKETTKSTKRKAADKAEKAPKAKAKKDPKAPKRALSAYMFFSQDWRERIKAENPDAGFGEIGKLLGAKWKELDESEKKPYIEQAARDKARAEKEKTDYDGQKADSAGSGDGDDDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.76
3 0.79
4 0.8
5 0.81
6 0.75
7 0.73
8 0.71
9 0.69
10 0.68
11 0.68
12 0.69
13 0.72
14 0.8
15 0.84
16 0.85
17 0.86
18 0.84
19 0.8
20 0.77
21 0.71
22 0.65
23 0.57
24 0.5
25 0.43
26 0.39
27 0.34
28 0.26
29 0.24
30 0.22
31 0.22
32 0.21
33 0.21
34 0.19
35 0.19
36 0.23
37 0.28
38 0.31
39 0.3
40 0.33
41 0.3
42 0.3
43 0.3
44 0.26
45 0.2
46 0.13
47 0.11
48 0.06
49 0.06
50 0.04
51 0.04
52 0.03
53 0.08
54 0.08
55 0.08
56 0.09
57 0.1
58 0.11
59 0.12
60 0.19
61 0.2
62 0.25
63 0.3
64 0.33
65 0.33
66 0.32
67 0.34
68 0.35
69 0.32
70 0.33
71 0.37
72 0.43
73 0.44
74 0.44
75 0.44
76 0.42
77 0.48
78 0.5
79 0.46
80 0.45
81 0.5
82 0.55
83 0.57
84 0.6
85 0.54
86 0.51
87 0.5
88 0.44
89 0.4
90 0.35
91 0.3
92 0.24
93 0.22
94 0.18
95 0.14
96 0.12
97 0.1