Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3AVK8

Protein Details
Accession G3AVK8   
Localization Confidence Low
Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
194-214VKGSPKYRKEHNMSNKNKNGTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14.5, cyto_nucl 13.5, nucl 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029063  SAM-dependent_MTases_sf  
IPR002935  SAM_O-MeTrfase  
Gene Ontology GO:0008171  F:O-methyltransferase activity  
GO:0032259  P:methylation  
KEGG spaa:SPAPADRAFT_63579  -  
Pfam View protein in Pfam  
PF01596  Methyltransf_3  
PROSITE View protein in PROSITE  
PS51682  SAM_OMT_I  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MTVDKSKEEKLADYILTHPQVESVRGNPREILRLIEEYAPTIKLGMIIGPHRGQVIIDEIKKVNPKVMIELGCYVGYSAILFASELPEDAKYYSFEVNEKFAAIATKLIRLAGLTHKIEIFVGKASDKLPEFRDGMSGPDERFTPVDFIFIDHWKDMYVPDLRILETLNLIAPGTVIAADNIIYPGAPDYAKYVKGSPKYRKEHNMSNKNKNGTKYLGRWNILYESETIEVVSPNGDKDGVEISKCVDYLSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.3
4 0.28
5 0.23
6 0.23
7 0.23
8 0.25
9 0.25
10 0.23
11 0.31
12 0.32
13 0.34
14 0.34
15 0.35
16 0.37
17 0.35
18 0.34
19 0.28
20 0.28
21 0.29
22 0.28
23 0.25
24 0.22
25 0.23
26 0.19
27 0.16
28 0.13
29 0.12
30 0.1
31 0.09
32 0.09
33 0.1
34 0.11
35 0.15
36 0.15
37 0.16
38 0.15
39 0.15
40 0.14
41 0.12
42 0.17
43 0.18
44 0.19
45 0.21
46 0.22
47 0.25
48 0.3
49 0.29
50 0.26
51 0.24
52 0.24
53 0.25
54 0.3
55 0.27
56 0.24
57 0.25
58 0.23
59 0.2
60 0.19
61 0.15
62 0.09
63 0.08
64 0.06
65 0.05
66 0.03
67 0.03
68 0.04
69 0.04
70 0.05
71 0.05
72 0.05
73 0.06
74 0.06
75 0.07
76 0.07
77 0.08
78 0.08
79 0.1
80 0.11
81 0.11
82 0.13
83 0.13
84 0.15
85 0.14
86 0.13
87 0.11
88 0.1
89 0.1
90 0.09
91 0.11
92 0.09
93 0.11
94 0.1
95 0.1
96 0.1
97 0.09
98 0.11
99 0.11
100 0.16
101 0.15
102 0.15
103 0.16
104 0.16
105 0.16
106 0.14
107 0.11
108 0.06
109 0.07
110 0.06
111 0.07
112 0.07
113 0.1
114 0.1
115 0.12
116 0.13
117 0.15
118 0.16
119 0.15
120 0.17
121 0.14
122 0.15
123 0.16
124 0.16
125 0.13
126 0.13
127 0.13
128 0.12
129 0.12
130 0.11
131 0.11
132 0.09
133 0.11
134 0.1
135 0.11
136 0.12
137 0.13
138 0.14
139 0.12
140 0.12
141 0.11
142 0.11
143 0.1
144 0.11
145 0.12
146 0.11
147 0.13
148 0.14
149 0.14
150 0.14
151 0.15
152 0.11
153 0.09
154 0.09
155 0.07
156 0.06
157 0.06
158 0.05
159 0.05
160 0.04
161 0.04
162 0.04
163 0.04
164 0.03
165 0.04
166 0.04
167 0.04
168 0.05
169 0.04
170 0.04
171 0.04
172 0.05
173 0.06
174 0.06
175 0.06
176 0.1
177 0.13
178 0.15
179 0.16
180 0.2
181 0.25
182 0.33
183 0.42
184 0.48
185 0.56
186 0.61
187 0.68
188 0.74
189 0.74
190 0.77
191 0.79
192 0.8
193 0.79
194 0.83
195 0.82
196 0.8
197 0.77
198 0.7
199 0.64
200 0.6
201 0.58
202 0.54
203 0.57
204 0.57
205 0.54
206 0.52
207 0.5
208 0.47
209 0.4
210 0.35
211 0.26
212 0.21
213 0.2
214 0.19
215 0.16
216 0.14
217 0.13
218 0.11
219 0.12
220 0.09
221 0.09
222 0.1
223 0.1
224 0.09
225 0.1
226 0.17
227 0.17
228 0.17
229 0.17
230 0.19
231 0.21
232 0.21