Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S7PWH2

Protein Details
Accession A0A2S7PWH2    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
134-158SLVQRAPKKAKKAKKQKRDFNYDAEHydrophilic
208-231LVDRAAKKAKKAKKQKRDFNYDAEHydrophilic
NLS Segment(s)
PositionSequence
138-151RAPKKAKKAKKQKR
212-224AAKKAKKAKKQKR
Subcellular Location(s) extr 13, E.R. 7, cyto 5
Family & Domain DBs
Amino Acid Sequences MPSVILAFCAMLAVQAAPTDMSNAVARSVAHEVVARDFNYNADGDEVDAEGNVIQKRDFDYDADGNEILPADSAEKRDFLYNADGDEIDAEGNVVKRGSFEYDADGNEILDDADLSERDFQYDADGNEIAPDGSLVQRAPKKAKKAKKQKRDFNYDAEGNEIDANGNIVQRDFNYDAEGNEIDAEGNIVQRDFNYDAEGNEIDASGQLVDRAAKKAKKAKKQKRDFNYDAEGNEIDAEGNLVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.06
4 0.06
5 0.06
6 0.08
7 0.08
8 0.1
9 0.11
10 0.11
11 0.11
12 0.12
13 0.12
14 0.13
15 0.16
16 0.15
17 0.14
18 0.16
19 0.16
20 0.19
21 0.22
22 0.2
23 0.18
24 0.18
25 0.18
26 0.17
27 0.16
28 0.13
29 0.11
30 0.1
31 0.09
32 0.09
33 0.09
34 0.07
35 0.07
36 0.06
37 0.05
38 0.09
39 0.09
40 0.1
41 0.09
42 0.11
43 0.13
44 0.16
45 0.17
46 0.14
47 0.19
48 0.21
49 0.21
50 0.22
51 0.2
52 0.17
53 0.16
54 0.15
55 0.09
56 0.07
57 0.06
58 0.07
59 0.08
60 0.1
61 0.11
62 0.11
63 0.12
64 0.14
65 0.14
66 0.14
67 0.17
68 0.15
69 0.15
70 0.15
71 0.14
72 0.12
73 0.12
74 0.1
75 0.06
76 0.05
77 0.04
78 0.04
79 0.05
80 0.05
81 0.05
82 0.05
83 0.05
84 0.07
85 0.09
86 0.1
87 0.1
88 0.13
89 0.14
90 0.15
91 0.15
92 0.14
93 0.11
94 0.09
95 0.09
96 0.06
97 0.04
98 0.04
99 0.03
100 0.03
101 0.03
102 0.04
103 0.06
104 0.06
105 0.07
106 0.07
107 0.07
108 0.09
109 0.11
110 0.1
111 0.1
112 0.11
113 0.1
114 0.1
115 0.1
116 0.07
117 0.05
118 0.05
119 0.03
120 0.04
121 0.05
122 0.04
123 0.09
124 0.12
125 0.15
126 0.23
127 0.27
128 0.37
129 0.45
130 0.55
131 0.61
132 0.7
133 0.78
134 0.81
135 0.87
136 0.88
137 0.88
138 0.88
139 0.81
140 0.75
141 0.71
142 0.62
143 0.52
144 0.44
145 0.35
146 0.26
147 0.22
148 0.16
149 0.1
150 0.07
151 0.08
152 0.06
153 0.07
154 0.06
155 0.06
156 0.07
157 0.07
158 0.13
159 0.13
160 0.13
161 0.16
162 0.16
163 0.16
164 0.18
165 0.18
166 0.13
167 0.11
168 0.11
169 0.07
170 0.07
171 0.07
172 0.05
173 0.06
174 0.06
175 0.06
176 0.06
177 0.06
178 0.11
179 0.12
180 0.12
181 0.14
182 0.15
183 0.15
184 0.17
185 0.17
186 0.13
187 0.12
188 0.11
189 0.08
190 0.07
191 0.08
192 0.05
193 0.05
194 0.05
195 0.06
196 0.09
197 0.11
198 0.15
199 0.23
200 0.26
201 0.34
202 0.43
203 0.52
204 0.6
205 0.7
206 0.76
207 0.8
208 0.87
209 0.89
210 0.88
211 0.89
212 0.81
213 0.76
214 0.71
215 0.62
216 0.52
217 0.44
218 0.35
219 0.25
220 0.22
221 0.16
222 0.09
223 0.07