Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S7QMI9

Protein Details
Accession A0A2S7QMI9    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPISKKDRINREHKKAEKAGBasic
NLS Segment(s)
PositionSequence
6-26KDRINREHKKAEKAGTRAPVK
Subcellular Location(s) nucl 13, mito 10.5, cyto_nucl 9.333, cyto_mito 7.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR026939  ZNF706/At2g23090_sf  
Amino Acid Sequences MPISKKDRINREHKKAEKAGTRAPVKANGLPVKAAKPMAQCKYCRKELDKTNVAILKTHAESHADKGWTPEKCWPEEFPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.78
3 0.78
4 0.74
5 0.69
6 0.65
7 0.63
8 0.59
9 0.53
10 0.49
11 0.46
12 0.41
13 0.38
14 0.38
15 0.32
16 0.3
17 0.29
18 0.28
19 0.24
20 0.23
21 0.22
22 0.17
23 0.19
24 0.25
25 0.29
26 0.32
27 0.34
28 0.41
29 0.46
30 0.49
31 0.49
32 0.47
33 0.49
34 0.53
35 0.59
36 0.56
37 0.51
38 0.51
39 0.5
40 0.46
41 0.38
42 0.31
43 0.26
44 0.22
45 0.22
46 0.17
47 0.17
48 0.19
49 0.22
50 0.27
51 0.23
52 0.23
53 0.27
54 0.33
55 0.31
56 0.33
57 0.36
58 0.35
59 0.39
60 0.42