FuNGI

A0A2S7PCA4

Protein Details

Accession

A0A2S7PCA4

Localization Confidence

Medium

Confidence Score

14.3

NoLS Segment(s)

Position	Sequence	Protein Nature
48-103	KYSNQPTTPPRTPRRTEQRQPASQGKHNSNVPESGSRKPRNRNKPKNVQNSPPTTK	Hydrophilic

NLS Segment(s)

Position	Sequence
84-92	RKPRNRNKP

Subcellular Location(s)

nucl 25.5, cyto_nucl 15

Family & Domain DBs

Pfam	View protein in Pfam PF15365 PNRC

Amino Acid Sequences

MSTMTPYKGIRHTQTFTTQITTTSSNNPQSPQEVSVQAHSQNIQSTMKYSNQPTTPPRTPRRTEQRQPASQGKHNSNVPESGSRKPRNRNKPKNVQNSPPTTKADRTTPPLTAAQSTTKPPSARPIQTPSAAAYAGSTFHASPAPSALPMPSFYSKSVPESPRTKSGSGMMDIKPSTDEVSQTPSSVQSFSKTPRIEESPLDLFFNADKREKAEKMRAQSANSVPTASMGPFNPPLTSPGSTIVTPQHVNQTNTTNASSSRASASGLFAMELDGPSNSGMPLGPAFSTPYHERINAARKTSSPLQSQKASPNKPQSPLDRSEALKAYLFSQPIPKASEPSADSNLGPALSVSTNAAMSYQGGNSSPSGPRNSGMSTKTPQSNYRYKGESKSSTDIPKSTGSGLRREFTPSKTPTKTPDRAFNFAQTPTPSRVYESQDSTARASPIPNPSTGVTPGSSDADLRGMENSLRRLLKLDSPGVAGSAV

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.56
2	0.56
3	0.51
4	0.48
5	0.41
6	0.34
7	0.34
8	0.32
9	0.28
10	0.3
11	0.36
12	0.38
13	0.4
14	0.41
15	0.41
16	0.41
17	0.41
18	0.37
19	0.33
20	0.32
21	0.31
22	0.32
23	0.33
24	0.31
25	0.31
26	0.29
27	0.27
28	0.25
29	0.27
30	0.25
31	0.22
32	0.23
33	0.24
34	0.28
35	0.32
36	0.33
37	0.36
38	0.37
39	0.43
40	0.47
41	0.53
42	0.56
43	0.61
44	0.66
45	0.69
46	0.72
47	0.76
48	0.8
49	0.81
50	0.82
51	0.84
52	0.84
53	0.82
54	0.84
55	0.82
56	0.78
57	0.75
58	0.74
59	0.68
60	0.64
61	0.61
62	0.57
63	0.51
64	0.46
65	0.42
66	0.42
67	0.4
68	0.41
69	0.48
70	0.52
71	0.58
72	0.66
73	0.73
74	0.76
75	0.84
76	0.87
77	0.88
78	0.91
79	0.93
80	0.94
81	0.91
82	0.89
83	0.86
84	0.85
85	0.8
86	0.74
87	0.68
88	0.61
89	0.58
90	0.52
91	0.5
92	0.46
93	0.47
94	0.45
95	0.41
96	0.4
97	0.39
98	0.37
99	0.32
100	0.29
101	0.27
102	0.26
103	0.28
104	0.29
105	0.3
106	0.29
107	0.28
108	0.35
109	0.38
110	0.41
111	0.43
112	0.46
113	0.46
114	0.47
115	0.47
116	0.4
117	0.33
118	0.28
119	0.22
120	0.15
121	0.12
122	0.1
123	0.1
124	0.09
125	0.07
126	0.08
127	0.1
128	0.1
129	0.09
130	0.11
131	0.11
132	0.1
133	0.1
134	0.1
135	0.09
136	0.1
137	0.14
138	0.15
139	0.16
140	0.17
141	0.19
142	0.2
143	0.24
144	0.31
145	0.3
146	0.34
147	0.38
148	0.41
149	0.46
150	0.48
151	0.44
152	0.37
153	0.39
154	0.35
155	0.32
156	0.33
157	0.26
158	0.26
159	0.25
160	0.24
161	0.2
162	0.17
163	0.17
164	0.12
165	0.13
166	0.1
167	0.16
168	0.16
169	0.16
170	0.16
171	0.15
172	0.15
173	0.16
174	0.15
175	0.11
176	0.14
177	0.17
178	0.24
179	0.23
180	0.24
181	0.26
182	0.3
183	0.3
184	0.28
185	0.3
186	0.26
187	0.26
188	0.25
189	0.21
190	0.17
191	0.16
192	0.18
193	0.15
194	0.14
195	0.13
196	0.17
197	0.23
198	0.25
199	0.29
200	0.35
201	0.37
202	0.4
203	0.48
204	0.46
205	0.43
206	0.46
207	0.43
208	0.37
209	0.33
210	0.28
211	0.19
212	0.17
213	0.17
214	0.11
215	0.11
216	0.08
217	0.1
218	0.11
219	0.12
220	0.11
221	0.11
222	0.12
223	0.14
224	0.15
225	0.13
226	0.14
227	0.15
228	0.14
229	0.15
230	0.15
231	0.14
232	0.14
233	0.13
234	0.19
235	0.22
236	0.23
237	0.24
238	0.25
239	0.24
240	0.26
241	0.25
242	0.18
243	0.15
244	0.16
245	0.15
246	0.12
247	0.12
248	0.1
249	0.11
250	0.1
251	0.11
252	0.09
253	0.08
254	0.08
255	0.06
256	0.07
257	0.06
258	0.06
259	0.05
260	0.04
261	0.05
262	0.05
263	0.05
264	0.04
265	0.04
266	0.04
267	0.04
268	0.05
269	0.05
270	0.05
271	0.05
272	0.07
273	0.07
274	0.11
275	0.13
276	0.17
277	0.18
278	0.18
279	0.19
280	0.23
281	0.32
282	0.31
283	0.32
284	0.3
285	0.29
286	0.34
287	0.39
288	0.39
289	0.37
290	0.39
291	0.41
292	0.43
293	0.45
294	0.48
295	0.51
296	0.5
297	0.51
298	0.55
299	0.55
300	0.56
301	0.59
302	0.57
303	0.53
304	0.53
305	0.5
306	0.44
307	0.41
308	0.41
309	0.37
310	0.32
311	0.27
312	0.23
313	0.21
314	0.2
315	0.2
316	0.16
317	0.2
318	0.2
319	0.21
320	0.25
321	0.24
322	0.23
323	0.24
324	0.28
325	0.24
326	0.28
327	0.29
328	0.25
329	0.25
330	0.23
331	0.22
332	0.17
333	0.14
334	0.09
335	0.08
336	0.07
337	0.07
338	0.07
339	0.07
340	0.07
341	0.07
342	0.08
343	0.06
344	0.07
345	0.08
346	0.08
347	0.08
348	0.08
349	0.1
350	0.1
351	0.13
352	0.15
353	0.17
354	0.2
355	0.21
356	0.21
357	0.23
358	0.25
359	0.27
360	0.27
361	0.29
362	0.29
363	0.34
364	0.39
365	0.39
366	0.43
367	0.45
368	0.51
369	0.5
370	0.53
371	0.52
372	0.51
373	0.54
374	0.56
375	0.56
376	0.53
377	0.53
378	0.53
379	0.54
380	0.54
381	0.48
382	0.43
383	0.39
384	0.34
385	0.32
386	0.33
387	0.28
388	0.33
389	0.36
390	0.35
391	0.33
392	0.39
393	0.39
394	0.39
395	0.46
396	0.43
397	0.49
398	0.51
399	0.54
400	0.55
401	0.61
402	0.64
403	0.6
404	0.65
405	0.63
406	0.63
407	0.63
408	0.61
409	0.55
410	0.48
411	0.47
412	0.41
413	0.38
414	0.38
415	0.39
416	0.33
417	0.34
418	0.38
419	0.4
420	0.43
421	0.43
422	0.44
423	0.44
424	0.46
425	0.45
426	0.43
427	0.37
428	0.32
429	0.29
430	0.3
431	0.35
432	0.34
433	0.32
434	0.31
435	0.31
436	0.33
437	0.33
438	0.3
439	0.21
440	0.21
441	0.22
442	0.22
443	0.21
444	0.17
445	0.16
446	0.16
447	0.16
448	0.15
449	0.14
450	0.13
451	0.16
452	0.2
453	0.22
454	0.27
455	0.28
456	0.28
457	0.3
458	0.32
459	0.36
460	0.38
461	0.39
462	0.33
463	0.34
464	0.34

A0A2S7PCA4

3D AlphaFold-predicted Structure Viewer