Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S7NPL6

Protein Details
Accession A0A2S7NPL6    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
11-30VDRRNSRRVQVESRRRSARPHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 15, nucl 14, cyto 12
Family & Domain DBs
CDD cd22541  SP5_N  
Amino Acid Sequences MLPKDDPIVFVDRRNSRRVQVESRRRSARPVSRVSETIITHHRRSSHRPSTSSITLPPPSPKPATPVPVVVPISSPVPSPTTPVYIPATPIHIPATPAAVPATPAVIPATPAVIPATPAFIPATPAPMAASPVTPQPRTPPQAPTPPESRIELIKVEEEWDGTAAGGRSSPSMSASHMSRRKSRRGSTSSFHRERERGSSREEVYIQRERIIERGTPPPPPSPKRTPPQEGGYRYVEGVGKGRDIDHTRVIGGYGHVREGEVDALARRRGSVTYVGESPRSSGRFGERERVVVDEGQRRREFYRRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.5
3 0.49
4 0.57
5 0.6
6 0.61
7 0.64
8 0.7
9 0.74
10 0.8
11 0.81
12 0.73
13 0.73
14 0.73
15 0.71
16 0.69
17 0.68
18 0.65
19 0.62
20 0.63
21 0.59
22 0.55
23 0.45
24 0.42
25 0.42
26 0.43
27 0.4
28 0.42
29 0.44
30 0.44
31 0.52
32 0.57
33 0.58
34 0.6
35 0.6
36 0.62
37 0.64
38 0.62
39 0.56
40 0.49
41 0.45
42 0.4
43 0.4
44 0.4
45 0.36
46 0.37
47 0.37
48 0.34
49 0.34
50 0.37
51 0.39
52 0.36
53 0.36
54 0.32
55 0.36
56 0.35
57 0.3
58 0.25
59 0.21
60 0.21
61 0.18
62 0.16
63 0.11
64 0.13
65 0.13
66 0.16
67 0.16
68 0.18
69 0.18
70 0.21
71 0.23
72 0.2
73 0.22
74 0.2
75 0.22
76 0.19
77 0.2
78 0.19
79 0.16
80 0.16
81 0.14
82 0.17
83 0.13
84 0.13
85 0.12
86 0.1
87 0.1
88 0.09
89 0.1
90 0.07
91 0.07
92 0.07
93 0.07
94 0.07
95 0.07
96 0.08
97 0.06
98 0.07
99 0.07
100 0.06
101 0.08
102 0.07
103 0.09
104 0.08
105 0.09
106 0.09
107 0.08
108 0.11
109 0.1
110 0.12
111 0.1
112 0.1
113 0.1
114 0.1
115 0.11
116 0.09
117 0.09
118 0.07
119 0.12
120 0.15
121 0.15
122 0.15
123 0.19
124 0.25
125 0.29
126 0.31
127 0.32
128 0.33
129 0.41
130 0.44
131 0.42
132 0.4
133 0.37
134 0.37
135 0.32
136 0.29
137 0.21
138 0.2
139 0.17
140 0.14
141 0.12
142 0.11
143 0.11
144 0.1
145 0.09
146 0.07
147 0.07
148 0.06
149 0.05
150 0.06
151 0.05
152 0.05
153 0.05
154 0.05
155 0.05
156 0.06
157 0.06
158 0.06
159 0.07
160 0.08
161 0.1
162 0.11
163 0.2
164 0.24
165 0.27
166 0.34
167 0.39
168 0.47
169 0.53
170 0.58
171 0.59
172 0.61
173 0.63
174 0.61
175 0.66
176 0.67
177 0.64
178 0.61
179 0.56
180 0.51
181 0.49
182 0.52
183 0.48
184 0.39
185 0.4
186 0.42
187 0.39
188 0.41
189 0.4
190 0.33
191 0.33
192 0.38
193 0.34
194 0.3
195 0.3
196 0.27
197 0.29
198 0.28
199 0.24
200 0.21
201 0.28
202 0.27
203 0.3
204 0.32
205 0.36
206 0.42
207 0.45
208 0.5
209 0.52
210 0.59
211 0.64
212 0.7
213 0.69
214 0.66
215 0.7
216 0.71
217 0.65
218 0.62
219 0.56
220 0.49
221 0.42
222 0.38
223 0.3
224 0.22
225 0.22
226 0.18
227 0.16
228 0.15
229 0.16
230 0.2
231 0.23
232 0.26
233 0.26
234 0.25
235 0.25
236 0.24
237 0.24
238 0.19
239 0.17
240 0.19
241 0.15
242 0.16
243 0.15
244 0.15
245 0.15
246 0.15
247 0.14
248 0.09
249 0.09
250 0.11
251 0.15
252 0.16
253 0.16
254 0.15
255 0.16
256 0.16
257 0.18
258 0.23
259 0.24
260 0.26
261 0.3
262 0.32
263 0.32
264 0.32
265 0.31
266 0.31
267 0.28
268 0.25
269 0.25
270 0.3
271 0.37
272 0.4
273 0.47
274 0.43
275 0.44
276 0.44
277 0.43
278 0.38
279 0.33
280 0.37
281 0.37
282 0.39
283 0.46
284 0.46
285 0.47
286 0.49