Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S7PDN6

Protein Details
Accession A0A2S7PDN6    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
167-211NGTAEKKKPGKPKGNSTSEGKEKKAAPKKEKKVPAVGRSQRKTRSBasic
NLS Segment(s)
PositionSequence
171-210EKKKPGKPKGNSTSEGKEKKAAPKKEKKVPAVGRSQRKTR
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 5.5, mito 4
Family & Domain DBs
Gene Ontology GO:0003677  F:DNA binding  
Amino Acid Sequences MGKKGNEIKKQGDENGPAVAIERSGNDVVKKASELTVESKGEAGGSTEEEKNDTNGESGETEEDKEISQENKPEANDTEEKEDVEMKDGDEKTEEDVEENGDAKNDEKVELKDNTNGQQEESNEKENGSEAEAQPGDKRKADEKVASEEDVEDDKDVKKQKTNGETNGTAEKKKPGKPKGNSTSEGKEKKAAPKKEKKVPAVGRSQRKTRSQGAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.45
3 0.38
4 0.3
5 0.26
6 0.2
7 0.14
8 0.11
9 0.1
10 0.12
11 0.13
12 0.15
13 0.15
14 0.17
15 0.18
16 0.19
17 0.19
18 0.16
19 0.16
20 0.16
21 0.18
22 0.19
23 0.24
24 0.24
25 0.23
26 0.22
27 0.2
28 0.19
29 0.16
30 0.13
31 0.08
32 0.09
33 0.12
34 0.13
35 0.13
36 0.15
37 0.15
38 0.15
39 0.15
40 0.14
41 0.11
42 0.1
43 0.11
44 0.1
45 0.1
46 0.11
47 0.1
48 0.11
49 0.1
50 0.11
51 0.09
52 0.1
53 0.11
54 0.11
55 0.13
56 0.15
57 0.17
58 0.19
59 0.2
60 0.21
61 0.21
62 0.24
63 0.25
64 0.23
65 0.26
66 0.23
67 0.23
68 0.21
69 0.22
70 0.17
71 0.17
72 0.15
73 0.11
74 0.17
75 0.17
76 0.16
77 0.15
78 0.15
79 0.14
80 0.16
81 0.15
82 0.09
83 0.1
84 0.1
85 0.09
86 0.1
87 0.07
88 0.06
89 0.06
90 0.06
91 0.08
92 0.07
93 0.08
94 0.09
95 0.1
96 0.14
97 0.17
98 0.17
99 0.19
100 0.2
101 0.23
102 0.25
103 0.24
104 0.21
105 0.21
106 0.21
107 0.22
108 0.23
109 0.23
110 0.19
111 0.19
112 0.18
113 0.16
114 0.15
115 0.12
116 0.13
117 0.1
118 0.14
119 0.14
120 0.15
121 0.17
122 0.22
123 0.22
124 0.21
125 0.23
126 0.23
127 0.28
128 0.31
129 0.33
130 0.31
131 0.36
132 0.36
133 0.35
134 0.31
135 0.26
136 0.24
137 0.2
138 0.17
139 0.11
140 0.1
141 0.1
142 0.15
143 0.21
144 0.22
145 0.26
146 0.31
147 0.39
148 0.48
149 0.54
150 0.55
151 0.56
152 0.55
153 0.53
154 0.56
155 0.5
156 0.42
157 0.37
158 0.4
159 0.39
160 0.45
161 0.52
162 0.54
163 0.62
164 0.69
165 0.78
166 0.79
167 0.8
168 0.77
169 0.74
170 0.72
171 0.71
172 0.68
173 0.59
174 0.55
175 0.52
176 0.59
177 0.62
178 0.64
179 0.65
180 0.71
181 0.78
182 0.83
183 0.87
184 0.83
185 0.84
186 0.83
187 0.8
188 0.8
189 0.81
190 0.81
191 0.79
192 0.82
193 0.79
194 0.78
195 0.76