Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T0FGD5

Protein Details
Accession A0A2T0FGD5    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-31VNIPKTRRTYCKGKDCRKHTQHKVTQYKAGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRRTYCKGKDCRKHTQHKVTQYKAGKASLYAQGKRRYDRKQRGYGGQTKQIFHKKAKTTKKIVLRLECTSCKTKAQLALKRCKHFELGGEKKQKGQALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.83
4 0.88
5 0.87
6 0.88
7 0.87
8 0.88
9 0.85
10 0.86
11 0.88
12 0.81
13 0.8
14 0.74
15 0.69
16 0.61
17 0.55
18 0.44
19 0.35
20 0.34
21 0.33
22 0.34
23 0.32
24 0.35
25 0.41
26 0.44
27 0.48
28 0.53
29 0.54
30 0.59
31 0.66
32 0.69
33 0.7
34 0.71
35 0.73
36 0.72
37 0.71
38 0.64
39 0.61
40 0.54
41 0.45
42 0.47
43 0.47
44 0.44
45 0.39
46 0.43
47 0.43
48 0.5
49 0.6
50 0.62
51 0.61
52 0.65
53 0.71
54 0.71
55 0.7
56 0.68
57 0.63
58 0.6
59 0.59
60 0.54
61 0.49
62 0.45
63 0.4
64 0.35
65 0.32
66 0.32
67 0.34
68 0.41
69 0.44
70 0.49
71 0.58
72 0.64
73 0.69
74 0.67
75 0.62
76 0.56
77 0.5
78 0.49
79 0.49
80 0.5
81 0.53
82 0.59
83 0.57
84 0.58
85 0.61
86 0.57