Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T0FFV1

Protein Details
Accession A0A2T0FFV1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
283-306GALKMYKLYIRKKKYRAYEPFEFSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 9, mito 7, extr 7, plas 1, pero 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR013320  ConA-like_dom_sf  
IPR005052  Lectin_leg  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF03388  Lectin_leg-like  
PROSITE View protein in PROSITE  
PS51328  L_LECTIN_LIKE  
CDD cd07308  lectin_leg-like  
Amino Acid Sequences MKVSRVVQGALWAYAAADRIVDSLALEYPFISHDYENDNYIYGGSAVLAKSYARLTADQPDQRGFLYARELIPAENFEIEVEFKIEGAGNSLYGDGMAVWLLSPDQEVAEGSVFGLKDYFMGTAILIDTYRNHRPGKAFPYVVLMQNDGRQGYDNDNDGKANELAGYSVRGLHNPASNTKMKIRYQGGELSVEINHKGRFDKAFSLPYNLDGAKRLAFSASTGQLSERHDIYSVRVTELDYQAPNKPAQSPQYAGNFAGQTRKSSPWTGLLVKLSLGVAGCVGALKMYKLYIRKKKYRAYEPFEFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.09
4 0.07
5 0.07
6 0.07
7 0.08
8 0.07
9 0.07
10 0.07
11 0.09
12 0.09
13 0.09
14 0.09
15 0.09
16 0.1
17 0.11
18 0.12
19 0.09
20 0.11
21 0.17
22 0.18
23 0.2
24 0.19
25 0.18
26 0.16
27 0.16
28 0.15
29 0.09
30 0.08
31 0.06
32 0.08
33 0.07
34 0.07
35 0.08
36 0.07
37 0.09
38 0.09
39 0.11
40 0.11
41 0.12
42 0.14
43 0.22
44 0.3
45 0.32
46 0.34
47 0.34
48 0.33
49 0.31
50 0.32
51 0.25
52 0.18
53 0.2
54 0.2
55 0.18
56 0.19
57 0.19
58 0.16
59 0.17
60 0.16
61 0.13
62 0.11
63 0.1
64 0.09
65 0.09
66 0.09
67 0.09
68 0.08
69 0.07
70 0.07
71 0.07
72 0.08
73 0.07
74 0.09
75 0.08
76 0.07
77 0.08
78 0.08
79 0.07
80 0.06
81 0.06
82 0.03
83 0.03
84 0.03
85 0.03
86 0.02
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.04
94 0.04
95 0.05
96 0.05
97 0.05
98 0.05
99 0.06
100 0.06
101 0.06
102 0.06
103 0.05
104 0.05
105 0.06
106 0.06
107 0.05
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.06
116 0.1
117 0.14
118 0.18
119 0.18
120 0.21
121 0.24
122 0.29
123 0.34
124 0.34
125 0.31
126 0.28
127 0.32
128 0.31
129 0.31
130 0.26
131 0.21
132 0.16
133 0.18
134 0.19
135 0.13
136 0.12
137 0.1
138 0.11
139 0.12
140 0.13
141 0.13
142 0.13
143 0.14
144 0.14
145 0.13
146 0.13
147 0.11
148 0.09
149 0.07
150 0.06
151 0.06
152 0.06
153 0.07
154 0.05
155 0.08
156 0.08
157 0.08
158 0.09
159 0.11
160 0.14
161 0.15
162 0.16
163 0.19
164 0.21
165 0.23
166 0.27
167 0.32
168 0.3
169 0.35
170 0.37
171 0.34
172 0.34
173 0.36
174 0.32
175 0.26
176 0.25
177 0.19
178 0.17
179 0.16
180 0.14
181 0.13
182 0.12
183 0.12
184 0.13
185 0.14
186 0.16
187 0.17
188 0.22
189 0.23
190 0.29
191 0.29
192 0.33
193 0.3
194 0.29
195 0.3
196 0.25
197 0.22
198 0.17
199 0.18
200 0.15
201 0.15
202 0.13
203 0.11
204 0.11
205 0.11
206 0.14
207 0.14
208 0.14
209 0.14
210 0.14
211 0.17
212 0.2
213 0.21
214 0.18
215 0.16
216 0.17
217 0.17
218 0.19
219 0.23
220 0.21
221 0.2
222 0.2
223 0.2
224 0.24
225 0.25
226 0.25
227 0.2
228 0.21
229 0.24
230 0.26
231 0.26
232 0.23
233 0.24
234 0.25
235 0.29
236 0.32
237 0.3
238 0.33
239 0.38
240 0.38
241 0.35
242 0.34
243 0.3
244 0.26
245 0.32
246 0.27
247 0.25
248 0.28
249 0.31
250 0.32
251 0.33
252 0.35
253 0.33
254 0.37
255 0.36
256 0.36
257 0.35
258 0.31
259 0.29
260 0.27
261 0.21
262 0.17
263 0.14
264 0.09
265 0.07
266 0.06
267 0.06
268 0.05
269 0.05
270 0.05
271 0.06
272 0.06
273 0.07
274 0.09
275 0.14
276 0.22
277 0.33
278 0.43
279 0.52
280 0.62
281 0.7
282 0.77
283 0.83
284 0.86
285 0.86
286 0.84