Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T0FEF0

Protein Details
Accession A0A2T0FEF0    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
121-149LKSKWKPDAKEHKKLQARWKRRGDRLKDVBasic
NLS Segment(s)
PositionSequence
122-147KSKWKPDAKEHKKLQARWKRRGDRLK
Subcellular Location(s) mito 22.5, cyto_mito 12.5, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR010487  NGRN/Rrg9  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF06413  Neugrin  
Amino Acid Sequences MQRLRWFSTGAQMLAAKPATKPIKRSVPYYIKGSWDLSGATEPVKPAVNVPKNWRKSDIDMWKRHMFALREKFPDGFKPIKRLSREKIEEVRDLKRAFPELTNDDLGMRFKVSPESIRHVLKSKWKPDAKEHKKLQARWKRRGDRLKDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.19
4 0.15
5 0.23
6 0.29
7 0.32
8 0.36
9 0.4
10 0.5
11 0.52
12 0.55
13 0.56
14 0.57
15 0.58
16 0.58
17 0.52
18 0.45
19 0.45
20 0.43
21 0.33
22 0.25
23 0.21
24 0.17
25 0.15
26 0.12
27 0.11
28 0.1
29 0.1
30 0.1
31 0.11
32 0.1
33 0.12
34 0.22
35 0.26
36 0.29
37 0.38
38 0.46
39 0.5
40 0.52
41 0.54
42 0.47
43 0.47
44 0.53
45 0.55
46 0.55
47 0.54
48 0.59
49 0.57
50 0.54
51 0.5
52 0.45
53 0.36
54 0.35
55 0.4
56 0.38
57 0.37
58 0.38
59 0.38
60 0.34
61 0.35
62 0.31
63 0.28
64 0.24
65 0.29
66 0.32
67 0.37
68 0.41
69 0.44
70 0.45
71 0.49
72 0.51
73 0.5
74 0.53
75 0.51
76 0.51
77 0.49
78 0.47
79 0.42
80 0.39
81 0.34
82 0.3
83 0.29
84 0.24
85 0.23
86 0.25
87 0.22
88 0.25
89 0.24
90 0.23
91 0.2
92 0.2
93 0.19
94 0.15
95 0.13
96 0.09
97 0.09
98 0.13
99 0.14
100 0.18
101 0.22
102 0.28
103 0.33
104 0.35
105 0.37
106 0.38
107 0.41
108 0.46
109 0.51
110 0.51
111 0.56
112 0.59
113 0.61
114 0.68
115 0.75
116 0.74
117 0.75
118 0.75
119 0.75
120 0.78
121 0.81
122 0.81
123 0.81
124 0.81
125 0.81
126 0.85
127 0.85
128 0.87
129 0.9