Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T0FMK8

Protein Details
Accession A0A2T0FMK8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
89-109EIKRGTKKWGGERNRRAQRAABasic
NLS Segment(s)
PositionSequence
91-109KRGTKKWGGERNRRAQRAA
Subcellular Location(s) mito 20.5, cyto_mito 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039603  Fyv4  
IPR019083  IGR_protein_motif  
IPR013761  SAM/pointed_sf  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF09597  IGR  
CDD cd09487  SAM_superfamily  
Amino Acid Sequences MFRAVLCRSYATAAVARAAVKPTAAVPDVETFLKKIGRNMEQYKEHFETWDDFASVSSTKLKDLGVETRDRRYLLQWFDRFSRGVELEEIKRGTKKWGGERNRRAQRAAHFGRLRAESS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.17
4 0.16
5 0.17
6 0.14
7 0.12
8 0.11
9 0.11
10 0.13
11 0.13
12 0.12
13 0.12
14 0.14
15 0.16
16 0.16
17 0.16
18 0.13
19 0.14
20 0.18
21 0.17
22 0.19
23 0.24
24 0.28
25 0.35
26 0.39
27 0.43
28 0.45
29 0.46
30 0.49
31 0.46
32 0.41
33 0.34
34 0.31
35 0.26
36 0.23
37 0.22
38 0.15
39 0.12
40 0.12
41 0.13
42 0.12
43 0.1
44 0.1
45 0.09
46 0.09
47 0.1
48 0.1
49 0.09
50 0.11
51 0.15
52 0.15
53 0.21
54 0.23
55 0.25
56 0.27
57 0.26
58 0.25
59 0.23
60 0.27
61 0.27
62 0.34
63 0.33
64 0.35
65 0.36
66 0.38
67 0.35
68 0.3
69 0.29
70 0.21
71 0.2
72 0.2
73 0.21
74 0.21
75 0.25
76 0.25
77 0.22
78 0.23
79 0.23
80 0.25
81 0.27
82 0.32
83 0.37
84 0.46
85 0.55
86 0.64
87 0.73
88 0.79
89 0.84
90 0.81
91 0.74
92 0.7
93 0.67
94 0.67
95 0.63
96 0.62
97 0.55
98 0.54
99 0.58