Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T0FGK4

Protein Details
Accession A0A2T0FGK4    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
165-193GTRVLMAYKKRRKADKHFFKRIKKNFDVVHydrophilic
NLS Segment(s)
PositionSequence
173-188KKRRKADKHFFKRIKK
Subcellular Location(s) cyto 11, cyto_nucl 10, nucl 7, pero 4, mito 2, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR033684  EFM6  
IPR019410  Methyltransf_16  
IPR029063  SAM-dependent_MTases_sf  
IPR012502  WAPL_dom  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0016279  F:protein-lysine N-methyltransferase activity  
GO:0018022  P:peptidyl-lysine methylation  
Pfam View protein in Pfam  
PF10294  Methyltransf_16  
PROSITE View protein in PROSITE  
PS51271  WAPL  
Amino Acid Sequences MDLDWGFVPINDVSDRGIQDLTFDGLLKEPLKVHQDGGAAGCGGRLWPAGELLSRYLIRQAEIPYRKIIELGSGTGLAGLAVAVGHPEADFELYITDQENLMHLMEENIVLNNQQQRVKARVLNWGEELPEYAKGADLILAADCVYLEFAFPLLEKTLLDLTNDGTRVLMAYKKRRKADKHFFKRIKKNFDVVEIRDFPEYEQFHRDVVYLFEIIRKTPPLKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.16
4 0.17
5 0.14
6 0.15
7 0.15
8 0.15
9 0.12
10 0.11
11 0.1
12 0.11
13 0.14
14 0.13
15 0.14
16 0.13
17 0.17
18 0.21
19 0.22
20 0.22
21 0.23
22 0.23
23 0.22
24 0.23
25 0.19
26 0.15
27 0.13
28 0.12
29 0.08
30 0.07
31 0.07
32 0.06
33 0.06
34 0.06
35 0.07
36 0.08
37 0.09
38 0.1
39 0.11
40 0.14
41 0.14
42 0.13
43 0.17
44 0.16
45 0.16
46 0.18
47 0.2
48 0.26
49 0.29
50 0.31
51 0.3
52 0.31
53 0.3
54 0.28
55 0.24
56 0.18
57 0.15
58 0.14
59 0.12
60 0.11
61 0.11
62 0.1
63 0.1
64 0.06
65 0.04
66 0.03
67 0.02
68 0.02
69 0.02
70 0.02
71 0.02
72 0.02
73 0.02
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.04
80 0.04
81 0.05
82 0.05
83 0.05
84 0.05
85 0.05
86 0.06
87 0.06
88 0.06
89 0.06
90 0.05
91 0.05
92 0.05
93 0.05
94 0.05
95 0.04
96 0.04
97 0.04
98 0.06
99 0.08
100 0.11
101 0.13
102 0.14
103 0.17
104 0.21
105 0.23
106 0.25
107 0.23
108 0.29
109 0.29
110 0.29
111 0.28
112 0.25
113 0.23
114 0.2
115 0.19
116 0.12
117 0.1
118 0.09
119 0.07
120 0.07
121 0.06
122 0.06
123 0.06
124 0.05
125 0.05
126 0.04
127 0.04
128 0.04
129 0.04
130 0.04
131 0.03
132 0.04
133 0.03
134 0.03
135 0.03
136 0.04
137 0.04
138 0.04
139 0.05
140 0.06
141 0.06
142 0.06
143 0.08
144 0.11
145 0.11
146 0.11
147 0.11
148 0.12
149 0.14
150 0.15
151 0.13
152 0.1
153 0.1
154 0.1
155 0.11
156 0.14
157 0.18
158 0.28
159 0.37
160 0.46
161 0.53
162 0.61
163 0.69
164 0.76
165 0.8
166 0.81
167 0.83
168 0.86
169 0.89
170 0.9
171 0.92
172 0.9
173 0.89
174 0.83
175 0.79
176 0.7
177 0.7
178 0.66
179 0.58
180 0.57
181 0.5
182 0.46
183 0.41
184 0.38
185 0.3
186 0.32
187 0.31
188 0.26
189 0.28
190 0.28
191 0.27
192 0.27
193 0.27
194 0.19
195 0.2
196 0.19
197 0.15
198 0.14
199 0.18
200 0.18
201 0.19
202 0.21
203 0.24