Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T0FG29

Protein Details
Accession A0A2T0FG29   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
65-87AAMDKWKRDKKQRDIEEKKRLAPBasic
NLS Segment(s)
PositionSequence
71-77KRDKKQR
Subcellular Location(s) cyto 21, cyto_nucl 14.5, nucl 4
Family & Domain DBs
Amino Acid Sequences MEDVLSKVSIVVSPALAQFAPVTLPYGYKQVESVPEVDTSSLPLIICDSDNYLAGLAAKHESRIAAMDKWKRDKKQRDIEEKKRLAPGYFDGTNRLLVPTAKQPPPETPENDALSIENLHLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.1
4 0.1
5 0.08
6 0.08
7 0.08
8 0.07
9 0.09
10 0.08
11 0.1
12 0.1
13 0.15
14 0.15
15 0.15
16 0.15
17 0.15
18 0.18
19 0.18
20 0.18
21 0.15
22 0.15
23 0.15
24 0.15
25 0.13
26 0.11
27 0.1
28 0.1
29 0.08
30 0.07
31 0.08
32 0.07
33 0.08
34 0.06
35 0.08
36 0.07
37 0.08
38 0.08
39 0.07
40 0.07
41 0.06
42 0.06
43 0.05
44 0.06
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.08
51 0.09
52 0.1
53 0.16
54 0.21
55 0.26
56 0.35
57 0.41
58 0.45
59 0.54
60 0.62
61 0.66
62 0.72
63 0.76
64 0.79
65 0.83
66 0.87
67 0.88
68 0.81
69 0.74
70 0.69
71 0.61
72 0.5
73 0.43
74 0.36
75 0.32
76 0.31
77 0.28
78 0.26
79 0.26
80 0.26
81 0.24
82 0.21
83 0.16
84 0.13
85 0.16
86 0.21
87 0.28
88 0.3
89 0.33
90 0.35
91 0.4
92 0.45
93 0.49
94 0.45
95 0.43
96 0.47
97 0.47
98 0.45
99 0.39
100 0.34
101 0.29
102 0.25