Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T0FGK9

Protein Details
Accession A0A2T0FGK9    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
103-123AERVYHPPRKGYKRSRQRAYVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 6.5, cyto_nucl 5.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MLSFIKRVSGLSHQPAPAAIQPSVDPTQLNLVVSQSDDCEDGYAQVSVRPMTYAEVASRNSVRSWVKPVRTLRPVEPRVAQEVSASTPRNIHAESDDLYGDLAERVYHPPRKGYKRSRQRAYV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.36
3 0.35
4 0.31
5 0.28
6 0.22
7 0.17
8 0.17
9 0.22
10 0.24
11 0.21
12 0.17
13 0.14
14 0.19
15 0.19
16 0.19
17 0.14
18 0.13
19 0.12
20 0.13
21 0.12
22 0.08
23 0.08
24 0.08
25 0.07
26 0.08
27 0.07
28 0.07
29 0.08
30 0.08
31 0.07
32 0.08
33 0.09
34 0.08
35 0.08
36 0.08
37 0.07
38 0.08
39 0.09
40 0.08
41 0.09
42 0.11
43 0.12
44 0.13
45 0.13
46 0.13
47 0.12
48 0.16
49 0.16
50 0.15
51 0.22
52 0.26
53 0.27
54 0.33
55 0.38
56 0.41
57 0.45
58 0.46
59 0.45
60 0.49
61 0.5
62 0.46
63 0.45
64 0.39
65 0.38
66 0.36
67 0.3
68 0.2
69 0.19
70 0.19
71 0.2
72 0.2
73 0.16
74 0.16
75 0.17
76 0.2
77 0.19
78 0.18
79 0.15
80 0.16
81 0.17
82 0.18
83 0.17
84 0.14
85 0.13
86 0.12
87 0.1
88 0.08
89 0.06
90 0.05
91 0.07
92 0.12
93 0.19
94 0.26
95 0.27
96 0.35
97 0.45
98 0.55
99 0.64
100 0.7
101 0.74
102 0.79
103 0.88