Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T0FE34

Protein Details
Accession A0A2T0FE34    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
19-45IRSLGTHHLRRRIRRCIRKQLRALSLMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 27
Family & Domain DBs
Amino Acid Sequences MVQKRVTVAASRLCPASRIRSLGTHHLRRRIRRCIRKQLRALSLMCLPSSISRRRHAVDSIQMTNLEAVEKDKTEELKGVKYTVTAQSFAEAISVMVYKNDKCGRIFECQLYPQPGGVLSSELILPGLTPRPLLGATLEDTAGSLYSSVIASMVMRQSPDDTRKLVIGLGAVGPKAGQPPGPDDREELLFVTKLVESCRVW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.34
4 0.31
5 0.32
6 0.33
7 0.36
8 0.4
9 0.48
10 0.54
11 0.57
12 0.58
13 0.64
14 0.69
15 0.74
16 0.78
17 0.79
18 0.8
19 0.81
20 0.85
21 0.87
22 0.9
23 0.9
24 0.9
25 0.88
26 0.84
27 0.78
28 0.69
29 0.6
30 0.54
31 0.45
32 0.36
33 0.27
34 0.21
35 0.19
36 0.24
37 0.28
38 0.29
39 0.32
40 0.36
41 0.39
42 0.41
43 0.4
44 0.39
45 0.4
46 0.41
47 0.39
48 0.35
49 0.33
50 0.3
51 0.27
52 0.22
53 0.14
54 0.08
55 0.07
56 0.08
57 0.08
58 0.09
59 0.1
60 0.11
61 0.12
62 0.15
63 0.15
64 0.18
65 0.18
66 0.18
67 0.16
68 0.16
69 0.18
70 0.19
71 0.19
72 0.16
73 0.15
74 0.15
75 0.15
76 0.14
77 0.12
78 0.07
79 0.05
80 0.04
81 0.05
82 0.04
83 0.05
84 0.06
85 0.06
86 0.11
87 0.14
88 0.15
89 0.15
90 0.19
91 0.21
92 0.25
93 0.27
94 0.24
95 0.24
96 0.24
97 0.26
98 0.26
99 0.23
100 0.18
101 0.16
102 0.14
103 0.13
104 0.11
105 0.09
106 0.06
107 0.06
108 0.06
109 0.06
110 0.06
111 0.05
112 0.04
113 0.05
114 0.06
115 0.06
116 0.06
117 0.06
118 0.08
119 0.08
120 0.08
121 0.08
122 0.08
123 0.09
124 0.1
125 0.1
126 0.09
127 0.09
128 0.08
129 0.08
130 0.06
131 0.04
132 0.03
133 0.04
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.06
140 0.08
141 0.08
142 0.08
143 0.09
144 0.12
145 0.18
146 0.22
147 0.23
148 0.24
149 0.24
150 0.25
151 0.25
152 0.22
153 0.17
154 0.13
155 0.11
156 0.11
157 0.11
158 0.1
159 0.09
160 0.09
161 0.09
162 0.1
163 0.1
164 0.1
165 0.11
166 0.18
167 0.26
168 0.29
169 0.29
170 0.3
171 0.32
172 0.33
173 0.32
174 0.26
175 0.22
176 0.19
177 0.18
178 0.17
179 0.15
180 0.14
181 0.16