Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T0FCD5

Protein Details
Accession A0A2T0FCD5    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
339-359GPEVIKLPFEHRRRKPERVFYBasic
NLS Segment(s)
Subcellular Location(s) nucl 9cyto 9cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR002495  Glyco_trans_8  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0016757  F:glycosyltransferase activity  
Pfam View protein in Pfam  
PF01501  Glyco_transf_8  
CDD cd02537  GT8_Glycogenin  
Amino Acid Sequences MTRSSCYTTLVYTAEYVLGAMALGHRLAKLDERPRVALVTPQLSHEVRDQLSTIWRLHEVPALTTGSSEELTLLGRPELDVSVTKIYAWTLPYDQVVYLDADTLPLKPLSDLDAEIDLGSIAAAPDVGWPDIFNSGVFACRPDTATFEGLKDLIKTSTSFDGSDQGLLNEFFAQAWNRLPFVYNVTLSASYQYEPAYRRFKSDIRVLHFIGKNKPWKPASLQADSVAANEMMYLWKKAAIEAGLFKHDLPPEAERSTIDYDPKRIIHPDPQRWEGDRFAPMRGGKPEGRPFARPATPAPGSPIISDEAESDEAEEPEASDQETTPVVYEENAYVFPVFGPEVIKLPFEHRRRKPERVFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.12
4 0.08
5 0.07
6 0.06
7 0.05
8 0.05
9 0.05
10 0.06
11 0.06
12 0.07
13 0.08
14 0.09
15 0.15
16 0.23
17 0.3
18 0.37
19 0.41
20 0.43
21 0.43
22 0.44
23 0.39
24 0.36
25 0.33
26 0.33
27 0.29
28 0.29
29 0.33
30 0.31
31 0.32
32 0.31
33 0.31
34 0.25
35 0.26
36 0.24
37 0.21
38 0.26
39 0.28
40 0.25
41 0.22
42 0.23
43 0.23
44 0.23
45 0.25
46 0.2
47 0.18
48 0.2
49 0.19
50 0.18
51 0.17
52 0.16
53 0.13
54 0.12
55 0.11
56 0.08
57 0.07
58 0.08
59 0.09
60 0.09
61 0.07
62 0.07
63 0.07
64 0.08
65 0.08
66 0.09
67 0.09
68 0.11
69 0.13
70 0.13
71 0.13
72 0.12
73 0.13
74 0.13
75 0.13
76 0.13
77 0.12
78 0.13
79 0.14
80 0.15
81 0.14
82 0.12
83 0.13
84 0.11
85 0.09
86 0.09
87 0.08
88 0.08
89 0.09
90 0.09
91 0.09
92 0.08
93 0.08
94 0.08
95 0.08
96 0.1
97 0.11
98 0.1
99 0.1
100 0.11
101 0.11
102 0.1
103 0.1
104 0.07
105 0.06
106 0.05
107 0.04
108 0.03
109 0.02
110 0.02
111 0.02
112 0.04
113 0.05
114 0.05
115 0.05
116 0.05
117 0.06
118 0.07
119 0.07
120 0.06
121 0.06
122 0.06
123 0.07
124 0.08
125 0.08
126 0.08
127 0.08
128 0.11
129 0.1
130 0.13
131 0.14
132 0.17
133 0.16
134 0.16
135 0.16
136 0.14
137 0.14
138 0.12
139 0.1
140 0.08
141 0.08
142 0.08
143 0.1
144 0.12
145 0.13
146 0.12
147 0.12
148 0.14
149 0.14
150 0.15
151 0.12
152 0.1
153 0.1
154 0.09
155 0.09
156 0.06
157 0.06
158 0.05
159 0.06
160 0.06
161 0.06
162 0.09
163 0.09
164 0.09
165 0.09
166 0.1
167 0.1
168 0.13
169 0.14
170 0.12
171 0.11
172 0.12
173 0.13
174 0.12
175 0.13
176 0.1
177 0.08
178 0.09
179 0.09
180 0.1
181 0.12
182 0.18
183 0.23
184 0.22
185 0.25
186 0.29
187 0.31
188 0.32
189 0.37
190 0.38
191 0.37
192 0.41
193 0.39
194 0.42
195 0.43
196 0.42
197 0.4
198 0.4
199 0.43
200 0.4
201 0.47
202 0.4
203 0.4
204 0.41
205 0.45
206 0.45
207 0.41
208 0.4
209 0.34
210 0.34
211 0.32
212 0.27
213 0.19
214 0.13
215 0.09
216 0.07
217 0.07
218 0.06
219 0.07
220 0.07
221 0.06
222 0.09
223 0.09
224 0.09
225 0.11
226 0.1
227 0.11
228 0.14
229 0.15
230 0.15
231 0.15
232 0.15
233 0.17
234 0.17
235 0.17
236 0.16
237 0.18
238 0.2
239 0.21
240 0.22
241 0.18
242 0.22
243 0.24
244 0.23
245 0.26
246 0.24
247 0.26
248 0.3
249 0.31
250 0.29
251 0.28
252 0.29
253 0.33
254 0.41
255 0.48
256 0.5
257 0.53
258 0.55
259 0.55
260 0.54
261 0.48
262 0.41
263 0.38
264 0.33
265 0.3
266 0.32
267 0.3
268 0.32
269 0.32
270 0.34
271 0.31
272 0.38
273 0.45
274 0.48
275 0.5
276 0.48
277 0.49
278 0.51
279 0.51
280 0.44
281 0.4
282 0.39
283 0.38
284 0.35
285 0.37
286 0.34
287 0.31
288 0.29
289 0.28
290 0.22
291 0.21
292 0.21
293 0.16
294 0.14
295 0.14
296 0.14
297 0.14
298 0.14
299 0.13
300 0.14
301 0.13
302 0.11
303 0.11
304 0.11
305 0.1
306 0.09
307 0.09
308 0.1
309 0.1
310 0.1
311 0.09
312 0.1
313 0.1
314 0.09
315 0.11
316 0.1
317 0.11
318 0.11
319 0.12
320 0.11
321 0.11
322 0.1
323 0.11
324 0.1
325 0.09
326 0.1
327 0.1
328 0.14
329 0.15
330 0.16
331 0.15
332 0.22
333 0.3
334 0.38
335 0.48
336 0.53
337 0.64
338 0.71
339 0.8